Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Slc12a5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Slc12a5 Polyclonal Antibody | anti-SLC12A5 antibody

Slc12a5 antibody - N-terminal region

Gene Names
Slc12a5; KCC2; mKIAA1176
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Slc12a5; Polyclonal Antibody; Slc12a5 antibody - N-terminal region; anti-SLC12A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS
Sequence Length
1115
Applicable Applications for anti-SLC12A5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Slc12a5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Slc12a5 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-SLC12A5 antibody
This is a rabbit polyclonal antibody against Slc12a5. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-SLC12A5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
solute carrier family 12 member 5 isoform 3
NCBI Official Synonym Full Names
solute carrier family 12, member 5
NCBI Official Symbol
Slc12a5
NCBI Official Synonym Symbols
KCC2; mKIAA1176
NCBI Protein Information
solute carrier family 12 member 5
UniProt Protein Name
Solute carrier family 12 member 5
Protein Family
UniProt Gene Name
Slc12a5
UniProt Synonym Gene Names
Kcc2; Kiaa1176
UniProt Entry Name
S12A5_MOUSE

Uniprot Description

KCC2: Mediates electroneutral potassium-chloride cotransport in mature neurons. Transport occurs under isotonic conditions, but is activated 20-fold by cell swelling. Important for Cl(-) homeostasis in neurons. Homomultimer and heteromultimer with other K-Cl cotransporters. Interacts with AP2A1. Brain specific. Detected in neuronal cells. Inhibited by WNK3. Belongs to the SLC12A transporter family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Transporter; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell projection; cell soma; membrane; integral to plasma membrane; integral to membrane; plasma membrane; perikaryon; intracellular; dendritic shaft

Molecular Function: protein binding; ammonium transmembrane transporter activity; symporter activity; protein kinase binding; cation:chloride symporter activity; potassium:chloride symporter activity

Biological Process: response to drug; multicellular organism growth; chloride transport; learning; ammonium transport; synaptic transmission; organic cation transport; transport; intracellular pH reduction; ion transport; transmembrane transport; potassium ion transport; thermosensory behavior

Research Articles on SLC12A5

Similar Products

Product Notes

The SLC12A5 slc12a5 (Catalog #AAA3207156) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slc12a5 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Slc12a5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC12A5 slc12a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDCEDGDGGA NPGDGNPKES SPFINSTDTE KGREYDGRNM ALFEEEMDTS. It is sometimes possible for the material contained within the vial of "Slc12a5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.