Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC12A4 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that SLC12A4 is expressed in PANC1)

Rabbit SLC12A4 Polyclonal Antibody | anti-SLC12A4 antibody

SLC12A4 antibody - N-terminal region

Gene Names
SLC12A4; KCC1; hKCC1; CTC-479C5.17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC12A4; Polyclonal Antibody; SLC12A4 antibody - N-terminal region; anti-SLC12A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFL
Sequence Length
1085
Applicable Applications for anti-SLC12A4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC12A4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC12A4 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that SLC12A4 is expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-SLC12A4 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateThere is BioGPS gene expression data showing that SLC12A4 is expressed in PANC1)
Related Product Information for anti-SLC12A4 antibody
This is a rabbit polyclonal antibody against SLC12A4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC12A4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. SLC12A4 may contribute to cell volume homeostasis in single cells. SLC12A4 may be involved in the regulation of basolateral Cl- exit in NaCl absorbing epitheli
Product Categories/Family for anti-SLC12A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
121kDa
NCBI Official Full Name
solute carrier family 12 member 4 isoform a
NCBI Official Synonym Full Names
solute carrier family 12 member 4
NCBI Official Symbol
SLC12A4
NCBI Official Synonym Symbols
KCC1; hKCC1; CTC-479C5.17
NCBI Protein Information
solute carrier family 12 member 4
UniProt Protein Name
Solute carrier family 12 member 4
Protein Family
UniProt Gene Name
SLC12A4
UniProt Synonym Gene Names
KCC1; hKCC1
UniProt Entry Name
S12A4_HUMAN

NCBI Description

This gene encodes a member of the SLC12A transporter family. The encoded protein mediates the coupled movement of potassium and chloride ions across the plasma membrane. This gene is expressed ubiquitously. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

KCC1: Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl(-) exit in NaCl absorbing epithelia. Isoform 4 has no transport activity. Belongs to the SLC12A transporter family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: membrane; integral to plasma membrane; lysosomal membrane; plasma membrane

Molecular Function: protein kinase binding; potassium:chloride symporter activity

Biological Process: transport; ion transport; chloride transport; cell volume homeostasis; transmembrane transport; potassium ion transport

Research Articles on SLC12A4

Similar Products

Product Notes

The SLC12A4 slc12a4 (Catalog #AAA3207094) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC12A4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC12A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC12A4 slc12a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPHFTVVPVD GPRRGDYDNL EGLSWVDYGE RAELDDSDGH GNHRESSPFL. It is sometimes possible for the material contained within the vial of "SLC12A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.