Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC11A1Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SLC11A1 Polyclonal Antibody | anti-SLC11A1 antibody

SLC11A1 Antibody - middle region

Gene Names
SLC11A1; LSH; NRAMP; NRAMP1
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC11A1; Polyclonal Antibody; SLC11A1 Antibody - middle region; anti-SLC11A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYEYVVARPEQGALLRGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLH
Sequence Length
550
Applicable Applications for anti-SLC11A1 antibody
Western Blot (WB)
Homology
Cow: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SLC11A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC11A1Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC11A1Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC11A1 antibody
This is a rabbit polyclonal antibody against SLC11A1. It was validated on Western Blot

Target Description: SLC11A1 is a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. It controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe2+ and Mn2+, cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.
Product Categories/Family for anti-SLC11A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
natural resistance-associated macrophage protein 1
NCBI Official Synonym Full Names
solute carrier family 11 member 1
NCBI Official Symbol
SLC11A1
NCBI Official Synonym Symbols
LSH; NRAMP; NRAMP1
NCBI Protein Information
natural resistance-associated macrophage protein 1
UniProt Protein Name
Natural resistance-associated macrophage protein 1
UniProt Gene Name
SLC11A1
UniProt Synonym Gene Names
LSH; NRAMP; NRAMP1; NRAMP 1

NCBI Description

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Macrophage-specific membrane transport function. Controls natural resistance to infection with intracellular parasites. Pathogen resistance involves sequestration of Fe2+ and Mn2+, cofactors of both prokaryotic and eukaryotic catalases and superoxide dismutases, not only to protect the macrophage against its own generation of reactive oxygen species, but to deny the cations to the pathogen for synthesis of its protective enzymes.

Research Articles on SLC11A1

Similar Products

Product Notes

The SLC11A1 slc11a1 (Catalog #AAA3207015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC11A1 Antibody - middle region reacts with Cow, Goat, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC11A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC11A1 slc11a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYEYVVARPE QGALLRGLFL PSCPGCGHPE LLQAVGIVGA IIMPHNIYLH. It is sometimes possible for the material contained within the vial of "SLC11A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.