Western Blot (WB)
(Host: RabbitTarget Name: SLASample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human SLA Polyclonal Antibody | anti-SLA antibody
SLA Antibody - N-terminal region
Gene Names
SLA; SLA1; SLAP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLA; Polyclonal Antibody; SLA Antibody - N-terminal region; anti-SLA antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLR
Sequence Length
249
Applicable Applications for anti-SLA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SLASample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SLASample Tissue: Human Testicular Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLA antibody
Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.
Product Categories/Family for anti-SLA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
src-like-adapter isoform a
NCBI Official Synonym Full Names
Src like adaptor
NCBI Official Symbol
SLA
NCBI Official Synonym Symbols
SLA1; SLAP
NCBI Protein Information
src-like-adapter
UniProt Protein Name
Src-like-adapter
Protein Family
UniProt Gene Name
SLA
UniProt Synonym Gene Names
SLAP; SLAP1; SLAP-1; hSLAP
UniProt Entry Name
SLAP1_HUMAN
Uniprot Description
SLAP: Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. Involved in the negative regulation of positive selection and mitosis of T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 8q24
Cellular Component: endosome
Molecular Function: protein binding; SH3/SH2 adaptor activity
Biological Process: positive regulation of signal transduction
Research Articles on SLA
Similar Products
Product Notes
The SLA sla (Catalog #AAA3222306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLA Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLA sla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGNSMKSTPA PAERPLPNPE GLDSDFLAVL SDYPSPDISP PIFRRGEKLR. It is sometimes possible for the material contained within the vial of "SLA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
