Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-VDR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)

Rabbit VDR Polyclonal Antibody | anti-VDR antibody

VDR antibody - N-terminal region

Gene Names
VDR; NR1I1; PPP1R163
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VDR; Polyclonal Antibody; VDR antibody - N-terminal region; anti-VDR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP
Sequence Length
427
Applicable Applications for anti-VDR antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VDR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-VDR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)

Western Blot (WB) (WB Suggested Anti-VDR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)
Related Product Information for anti-VDR antibody
This is a rabbit polyclonal antibody against VDR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
vitamin D3 receptor isoform VDRA
NCBI Official Synonym Full Names
vitamin D receptor
NCBI Official Symbol
VDR
NCBI Official Synonym Symbols
NR1I1; PPP1R163
NCBI Protein Information
vitamin D3 receptor
UniProt Protein Name
Vitamin D3 receptor
Protein Family
UniProt Gene Name
VDR
UniProt Synonym Gene Names
NR1I1; VDR
UniProt Entry Name
VDR_HUMAN

NCBI Description

This gene encodes vitamin D3 receptor, which is a member of the nuclear hormone receptor superfamily of ligand-inducible transcription factors. This receptor also functions as a receptor for the secondary bile acid, lithocholic acid. Downstream targets of vitamin D3 receptor are principally involved in mineral metabolism, though this receptor regulates a variety of other metabolic pathways, such as those involved in immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene, and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Jun 2018]

Uniprot Description

VDR: Nuclear hormone receptor. Transcription factor that mediates the action of vitamin D3 by controlling the expression of hormone sensitive genes. Regulates transcription of hormone sensitive genes via its association with the WINAC complex, a chromatin-remodeling complex. Recruited to promoters via its interaction with the WINAC complex subunit BAZ1B/WSTF, which mediates the interaction with acetylated histones, an essential step for VDR-promoter association. Plays a central role in calcium homeostasis. Defects in VDR are the cause of rickets vitamin D- dependent type 2A (VDDR2A). A disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. Belongs to the nuclear hormone receptor family. NR1 subfamily.

Protein type: Nuclear receptor; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13.11

Cellular Component: nucleoplasm; nucleus; receptor complex

Molecular Function: retinoid X receptor binding; protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; vitamin D3 receptor activity; transcription factor activity

Biological Process: lactation; transcription initiation from RNA polymerase II promoter; cell morphogenesis; positive regulation of apoptosis involved in mammary gland involution; negative regulation of transcription from RNA polymerase II promoter; decidualization; signal transduction; intestinal absorption; cellular calcium ion homeostasis; negative regulation of cell proliferation; calcium ion transport; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; negative regulation of transcription, DNA-dependent; skeletal development; positive regulation of keratinocyte differentiation

Disease: Vitamin D-dependent Rickets, Type 2a; Osteoporosis

Research Articles on VDR

Similar Products

Product Notes

The VDR vdr (Catalog #AAA3207805) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VDR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VDR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VDR vdr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILKRKEEEAL KDSLRPKLSE EQQRIIAILL DAHHKTYDPT YSDFCQFRPP. It is sometimes possible for the material contained within the vial of "VDR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.