Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SHMT2 Polyclonal Antibody | anti-SHMT2 antibody

SHMT2 antibody - C-terminal region

Gene Names
SHMT2; GLYA; SHMT; HEL-S-51e
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
SHMT2; Polyclonal Antibody; SHMT2 antibody - C-terminal region; anti-SHMT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE
Sequence Length
504
Applicable Applications for anti-SHMT2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SHMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(SHMT2 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in Kupffer cellsPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (SHMT2 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in Kupffer cellsPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-SHMT2 Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SHMT2 Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SHMT2 antibody
This is a rabbit polyclonal antibody against SHMT2. It was validated on Western Blot and immunohistochemistry

Target Description: SHMT2 plays a role in interconversion of serine and glycine.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
serine hydroxymethyltransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
serine hydroxymethyltransferase 2
NCBI Official Symbol
SHMT2
NCBI Official Synonym Symbols
GLYA; SHMT; HEL-S-51e
NCBI Protein Information
serine hydroxymethyltransferase, mitochondrial
UniProt Protein Name
Serine hydroxymethyltransferase, mitochondrial
UniProt Gene Name
SHMT2
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYM_HUMAN

NCBI Description

This gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glycine synthesis. The activity of the encoded protein has been suggested to be the primary source of intracellular glycine. The gene which encodes the cytosolic form of this enzyme is located on chromosome 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

SHMT2: Contributes to the de novo mitochondrial thymidylate biosynthesis pathway. Required to prevent uracil accumulation in mtDNA. Interconversion of serine and glycine. Associates with mitochondrial DNA. Belongs to the SHMT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Methyltransferase; Energy Metabolism - methane; Cofactor and Vitamin Metabolism - one carbon pool by folate; Mitochondrial; EC 2.1.2.1; Other Amino Acids Metabolism - cyanoamino acid

Chromosomal Location of Human Ortholog: 12q12-q14

Cellular Component: microtubule cytoskeleton; mitochondrion; mitochondrial matrix; mitochondrial inner membrane; mitochondrial intermembrane space

Molecular Function: L-allo-threonine aldolase activity; identical protein binding; amino acid binding; glycine hydroxymethyltransferase activity; chromatin binding; pyridoxal phosphate binding

Biological Process: L-serine biosynthetic process; positive regulation of cell proliferation; one-carbon compound metabolic process; glycine biosynthetic process from serine; protein homotetramerization

Research Articles on SHMT2

Similar Products

Product Notes

The SHMT2 shmt2 (Catalog #AAA3208072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHMT2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHMT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the SHMT2 shmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELVSITANKN TCPGDRSAIT PGGLRLGAPA LTSRQFREDD FRRVVDFIDE. It is sometimes possible for the material contained within the vial of "SHMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.