Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysateSREK1 is supported by BioGPS gene expression data to be expressed in HT1080)

Rabbit SFRS12 Polyclonal Antibody | anti-SREK1 antibody

SFRS12 antibody - N-terminal region

Gene Names
SREK1; SFRS12; SRrp86; SRrp508
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SFRS12; Polyclonal Antibody; SFRS12 antibody - N-terminal region; anti-SREK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL
Sequence Length
624
Applicable Applications for anti-SREK1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysateSREK1 is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HT1080 cell lysateSREK1 is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-SREK1 antibody
This is a rabbit polyclonal antibody against SFRS12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074
Product Categories/Family for anti-SREK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
splicing regulatory glutamine/lysine-rich protein 1 isoform a
NCBI Official Synonym Full Names
splicing regulatory glutamic acid and lysine rich protein 1
NCBI Official Symbol
SREK1
NCBI Official Synonym Symbols
SFRS12; SRrp86; SRrp508
NCBI Protein Information
splicing regulatory glutamine/lysine-rich protein 1
UniProt Protein Name
Splicing regulatory glutamine/lysine-rich protein 1
UniProt Gene Name
SREK1
UniProt Synonym Gene Names
SFRS12; SRRP86; SRrp86; SRrp508
UniProt Entry Name
SREK1_HUMAN

NCBI Description

This gene encodes a member of a family of serine/arginine-rich (SR) splicing proteins containing RNA recognition motif (RRM) domains. The encoded protein interacts with other SR proteins to modulate splice site selection. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Research Articles on SREK1

Similar Products

Product Notes

The SREK1 srek1 (Catalog #AAA3210480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFRS12 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SFRS12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SREK1 srek1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPSSVGVAQH LTNTVFIDRA LIVVPCAEGK IPEESKALSL LAPAPTMTSL. It is sometimes possible for the material contained within the vial of "SFRS12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.