Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SREK1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human SREK1 Polyclonal Antibody | anti-SREK1 antibody
SREK1 Polyclonal Antibody
Gene Names
SREK1; SFRS12; SRrp86; SRrp508
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SREK1; Polyclonal Antibody; SREK1 Polyclonal Antibody; SFRS12; SRrp508; SRrp86; anti-SREK1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MTSLMPGAGLLPIPTPNPLTTLGVSLSSLGAIPAAALDPNIATLGEIPQPPLMGNVDPSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQNSVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAIEPE
Sequence Length
624
Applicable Applications for anti-SREK1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human SREK1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
MCF-7, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SREK1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SREK1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-SREK1 antibody
This gene encodes a member of a family of serine/arginine-rich (SR) splicing proteins containing RNA recognition motif (RRM) domains. The encoded protein interacts with other SR proteins to modulate splice site selection. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-SREK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 59kDa; 71kDa
Observed: 59kDa
Observed: 59kDa
NCBI Official Full Name
splicing regulatory glutamine/lysine-rich protein 1 isoform a
NCBI Official Synonym Full Names
splicing regulatory glutamic acid and lysine rich protein 1
NCBI Official Symbol
SREK1
NCBI Official Synonym Symbols
SFRS12; SRrp86; SRrp508
NCBI Protein Information
splicing regulatory glutamine/lysine-rich protein 1
UniProt Protein Name
Splicing regulatory glutamine/lysine-rich protein 1
Protein Family
UniProt Gene Name
SREK1
UniProt Synonym Gene Names
SFRS12; SRRP86; SRrp86; SRrp508
NCBI Description
This gene encodes a member of a family of serine/arginine-rich (SR) splicing proteins containing RNA recognition motif (RRM) domains. The encoded protein interacts with other SR proteins to modulate splice site selection. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]
Uniprot Description
Participates in the regulation of alternative splicing by modulating the activity of other splice facors. Inhibits the splicing activity of SFRS1, SFRS2 and SFRS6. Augments the splicing activity of SFRS3 ().
Research Articles on SREK1
Similar Products
Product Notes
The SREK1 srek1 (Catalog #AAA9133283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SREK1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SREK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the SREK1 srek1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSLMPGAGL LPIPTPNPLT TLGVSLSSLG AIPAAALDPN IATLGEIPQP PLMGNVDPSK IDEIRRTVYV GNLNSQTTTA DQLLEFFKQV GEVKFVRMAG DETQPTRFAF VEFADQNSVP RALAFNGVMF GDRPLKINHS NNAIVKPPEM TPQAAAKELE EVMKRVREAQ SFISAAIEPE. It is sometimes possible for the material contained within the vial of "SREK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
