Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit anti-Human IL5 Polyclonal Antibody | anti-IL5 antibody

IL5 antibody - middle region

Gene Names
IL5; EDF; TRF; IL-5
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL5; Polyclonal Antibody; IL5 antibody - middle region; anti-IL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL
Sequence Length
134
Applicable Applications for anti-IL5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-IL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-IL5 antibody
This is a rabbit polyclonal antibody against IL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL5 is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The protein encoded by this gene is a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. This cytokine is a main regulator of eosinopoiesis, eosinophil maturation and activation. The elevated production of this cytokine is reported to be related to asthma or hypereosinophilic syndromes. The receptor of this cytokine is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene, together with those for interleukin 4 (IL4), interleukin 13 (IL13), and CSF2, form a cytokine gene cluster on chromosome 5. This cytokine, IL4, and IL13 are found to be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
interleukin-5
NCBI Official Synonym Full Names
interleukin 5
NCBI Official Symbol
IL5
NCBI Official Synonym Symbols
EDF; TRF; IL-5
NCBI Protein Information
interleukin-5
UniProt Protein Name
Interleukin-5
Protein Family
UniProt Gene Name
IL5
UniProt Synonym Gene Names
IL-5; TRF
UniProt Entry Name
IL5_HUMAN

NCBI Description

This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 . This gene, IL4, and IL13 may be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. [provided by RefSeq, Jul 2013]

Uniprot Description

IL5: Factor that induces terminal differentiation of late- developing B-cells to immunoglobulin secreting cells. Belongs to the IL-5 family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; interleukin-5 receptor binding; growth factor activity; cytokine activity

Biological Process: positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of B cell proliferation; positive regulation of JAK-STAT cascade; positive regulation of transcription factor activity; immune response; positive regulation of immunoglobulin secretion; inflammatory response; positive regulation of eosinophil differentiation

Research Articles on IL5

Similar Products

Product Notes

The IL5 il5 (Catalog #AAA3211622) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL5 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL5 il5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LESQTVQGGT VERLFKNLSL IKKYIDGQKK KCGEERRRVN QFLDYLQEFL. It is sometimes possible for the material contained within the vial of "IL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.