Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Rabbit SF4 Polyclonal Antibody | anti-SUGP1 antibody

SF4 antibody - C-terminal region

Gene Names
SUGP1; RBP; SF4; F23858
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SF4; Polyclonal Antibody; SF4 antibody - C-terminal region; anti-SUGP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY
Sequence Length
645
Applicable Applications for anti-SUGP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-SF4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: COLO205 cell lysate)
Related Product Information for anti-SUGP1 antibody
This is a rabbit polyclonal antibody against SF4. It was validated on Western Blot

Target Description: SF4 is a member of the SURP family of splicing factors.
Product Categories/Family for anti-SUGP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72kDa
NCBI Official Full Name
SURP and G-patch domain-containing protein 1
NCBI Official Synonym Full Names
SURP and G-patch domain containing 1
NCBI Official Symbol
SUGP1
NCBI Official Synonym Symbols
RBP; SF4; F23858
NCBI Protein Information
SURP and G-patch domain-containing protein 1
UniProt Protein Name
SURP and G-patch domain-containing protein 1
UniProt Gene Name
SUGP1
UniProt Synonym Gene Names
SF4
UniProt Entry Name
SUGP1_HUMAN

NCBI Description

SF4 is a member of the SURP family of splicing factors.[supplied by OMIM, Sep 2003]

Uniprot Description

Function: Plays a role in pre-mRNA splicing.

Subunit structure: Component of the spliceosome. Ref.6

Subcellular location: Nucleus

Probable.

Tissue specificity: Detected in adult testis and heart, and in adult and fetal brain, kidney and skeletal muscle. Ref.1

Sequence similarities: Contains 1 G-patch domain.Contains 2 SURP motif repeats.

Sequence caution: The sequence AAC08052.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAL68960.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAL68961.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on SUGP1

Similar Products

Product Notes

The SUGP1 sugp1 (Catalog #AAA3205687) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SF4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUGP1 sugp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGSEGQGIKN PVNKGTTTVD GAGFGIDRPA ELSKEDDEYE AFRKRMMLAY. It is sometimes possible for the material contained within the vial of "SF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.