Immunohistochemistry (IHC)
(SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
Rabbit SF3B1 Polyclonal Antibody | anti-SF3B1 antibody
SF3B1 Antibody
Gene Names
SF3B1; MDS; PRP10; Hsh155; PRPF10; SAP155; SF3b155
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
SF3B1; Polyclonal Antibody; SF3B1 Antibody; Rabbit Polyclonal SF3B1 Antibody raised against the N terminal of SF3B1; Polyclonal SF3B1 antibody; Anti-SF3B1 antibody; SFB1-3; SFB1 3 antibody; SF3b155 antibody; Splicing Factor 3B Subunit 1 155Kda antibody; PRP10 antibody; SAP155 antibody; SFB1 3; SFB1-3 antibody; anti-SF3B1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
SF3B1 antibody was raised against the N terminal of SF3B1
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
501
Applicable Applications for anti-SF3B1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
This is a rabbit polyclonal antibody against SF3B1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Immunogen
SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
Cross-Reactivity
Human,Mouse,Rat,Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Immunohistochemistry (IHC)
(SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
Immunohistochemistry (IHC)
(SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.)
Western Blot (WB)
(SF3B1 antibody used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(SF3B1 antibody used at 1.25 ug/ml to detect target protein.)
Immunohistochemistry (IHC)
(SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epidermal cells (arrows) in Human Skin. Magnification is at 400X)
Immunohistochemistry (IHC)
(SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epidermal cells (arrows) in Human Skin. Magnification is at 400X)
Related Product Information for anti-SF3B1 antibody
SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.
Product Categories/Family for anti-SF3B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
143 kDa (MW of target protein)
NCBI Official Full Name
SF3B1 protein, partial
NCBI Official Synonym Full Names
splicing factor 3b subunit 1
NCBI Official Symbol
SF3B1
NCBI Official Synonym Symbols
MDS; PRP10; Hsh155; PRPF10; SAP155; SF3b155
NCBI Protein Information
splicing factor 3B subunit 1
Protein Family
NCBI Description
This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Research Articles on SF3B1
Similar Products
Product Notes
The SF3B1 (Catalog #AAA5312290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SF3B1 Antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's SF3B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). This is a rabbit polyclonal antibody against SF3B1. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the SF3B1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SF3B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
