Western Blot (WB)
(WB Suggested Anti-SETDB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Rabbit SETDB2 Polyclonal Antibody | anti-SETDB2 antibody
SETDB2 antibody - N-terminal region
Gene Names
SETDB2; CLLD8; CLLL8; KMT1F; C13orf4
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SETDB2; Polyclonal Antibody; SETDB2 antibody - N-terminal region; anti-SETDB2 antibody
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTGNKE
Sequence Length
707
Applicable Applications for anti-SETDB2 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SETDB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SETDB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-SETDB2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-SETDB2 antibody
This is a rabbit polyclonal antibody against SETDB2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.
Target Description: Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the active site and flanking cysteine residues required for catalytic activity.
Product Categories/Family for anti-SETDB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
SETDB2 protein
NCBI Official Synonym Full Names
SET domain bifurcated histone lysine methyltransferase 2
NCBI Official Symbol
SETDB2
NCBI Official Synonym Symbols
CLLD8; CLLL8; KMT1F; C13orf4
NCBI Protein Information
histone-lysine N-methyltransferase SETDB2
UniProt Protein Name
Histone-lysine N-methyltransferase SETDB2
Protein Family
UniProt Gene Name
SETDB2
UniProt Synonym Gene Names
C13orf4; CLLD8; KMT1F
UniProt Entry Name
SETB2_HUMAN
NCBI Description
This gene encodes a member of a family of proteins that contain a methyl-CpG-binding domain (MBD) and a SET domain and function as histone methyltransferases. This protein is recruited to heterochromatin and plays a role in the regulation of chromosome segregation. This region is commonly deleted in chronic lymphocytic leukemia. Naturally-occuring readthrough transcription occurs from this gene to the downstream PHF11 (PHD finger protein 11) gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Research Articles on SETDB2
1. SETDB2 transcripts were overexpressed in renal cell tumor subtypes and associated with prognosis.
Similar Products
Product Notes
The SETDB2 setdb2 (Catalog #AAA3209260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SETDB2 antibody - N-terminal region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SETDB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SETDB2 setdb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASQKEVNAQS SDPMPVTQKE QENKSNAFPS TSCENSFPED CTFLTTGNKE. It is sometimes possible for the material contained within the vial of "SETDB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
