Western Blot (WB)
(WB Suggested Anti-SERTAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSERTAD2 is supported by BioGPS gene expression data to be expressed in COLO205)
Rabbit SERTAD2 Polyclonal Antibody | anti-SERTAD2 antibody
SERTAD2 antibody - N-terminal region
Gene Names
SERTAD2; Sei-2; TRIPBR2; TRIP-Br2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERTAD2; Polyclonal Antibody; SERTAD2 antibody - N-terminal region; anti-SERTAD2 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRP
Sequence Length
314
Applicable Applications for anti-SERTAD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERTAD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SERTAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSERTAD2 is supported by BioGPS gene expression data to be expressed in COLO205)
Western Blot (WB)
(WB Suggested Anti-SERTAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateSERTAD2 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-SERTAD2 antibody
This is a rabbit polyclonal antibody against SERTAD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SERTAD2 acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors.
Target Description: SERTAD2 acts at E2F-responsive promoters to integrate signals provided by PHD- and/or bromodomain-containing transcription factors.
Product Categories/Family for anti-SERTAD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
SERTA domain-containing protein 2
NCBI Official Synonym Full Names
SERTA domain containing 2
NCBI Official Symbol
SERTAD2
NCBI Official Synonym Symbols
Sei-2; TRIPBR2; TRIP-Br2
NCBI Protein Information
SERTA domain-containing protein 2
UniProt Protein Name
SERTA domain-containing protein 2
Protein Family
UniProt Gene Name
SERTAD2
UniProt Synonym Gene Names
KIAA0127; TRIP-Br2
Uniprot Description
Acts at E2F-responsive promoters as coregulator to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. May act as coactivator as well as corepressor of E2F1-TFDP1 and E2F4-TFDP1 complexes on E2F consensus binding sites, which would activate or inhibit E2F-target genes expression. Modulates fat storage by down-regulating the expression of key genes involved in adipocyte lipolysis, thermogenesis and oxidative metabolism.
Research Articles on SERTAD2
Similar Products
Product Notes
The SERTAD2 sertad2 (Catalog #AAA3210359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERTAD2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SERTAD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERTAD2 sertad2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQRQTIFNIS LMKLYNHRPL TEPSLQKTVL INNMLRRIQE ELKQEGSLRP. It is sometimes possible for the material contained within the vial of "SERTAD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
