Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SERPINI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)

Rabbit SERPINI1 Polyclonal Antibody | anti-SERPINI1 antibody

SERPINI1 antibody - middle region

Gene Names
SERPINI1; PI12; neuroserpin
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERPINI1; Polyclonal Antibody; SERPINI1 antibody - middle region; anti-SERPINI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF
Sequence Length
410
Applicable Applications for anti-SERPINI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SERPINI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SERPINI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-SERPINI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-SERPINI1 antibody
This is a rabbit polyclonal antibody against SERPINI1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in t
Product Categories/Family for anti-SERPINI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
neuroserpin
NCBI Official Synonym Full Names
serpin family I member 1
NCBI Official Symbol
SERPINI1
NCBI Official Synonym Symbols
PI12; neuroserpin
NCBI Protein Information
neuroserpin
UniProt Protein Name
Neuroserpin
Protein Family
UniProt Gene Name
SERPINI1
UniProt Synonym Gene Names
PI12; PI-12
UniProt Entry Name
NEUS_HUMAN

NCBI Description

This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

SERPINI1: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator. Defects in SERPINI1 are the cause of familial encephalopathy with neuroserpin inclusion bodies (FEN1B). FEN1B is characterized clinically as an autosomal dominantly inherited dementia, histologically by unique neuronal inclusion bodies and biochemically by polymers of neuroserpin. Belongs to the serpin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q26.1

Cellular Component: extracellular space

Molecular Function: serine-type endopeptidase inhibitor activity

Biological Process: regulation of cell adhesion; central nervous system development; peripheral nervous system development

Disease: Encephalopathy, Familial, With Neuroserpin Inclusion Bodies

Research Articles on SERPINI1

Similar Products

Product Notes

The SERPINI1 serpini1 (Catalog #AAA3212881) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINI1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINI1 serpini1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALINAVYFKG NWKSQFRPEN TRTFSFTKDD ESEVQIPMMY QQGEFYYGEF. It is sometimes possible for the material contained within the vial of "SERPINI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.