Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SERPING1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SERPING1 Polyclonal Antibody | anti-SERPING1 antibody

SERPING1 Antibody - N-terminal region

Gene Names
SERPING1; C1IN; C1NH; HAE1; HAE2; C1INH
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SERPING1; Polyclonal Antibody; SERPING1 Antibody - N-terminal region; anti-SERPING1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: SSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNS
Sequence Length
500
Applicable Applications for anti-SERPING1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human SERPING1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SERPING1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SERPING1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SERPING1 antibody
This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its protein inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. Deficiency of this protein is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform.
Product Categories/Family for anti-SERPING1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
710
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
plasma protease C1 inhibitor
NCBI Official Synonym Full Names
serpin family G member 1
NCBI Official Symbol
SERPING1
NCBI Official Synonym Symbols
C1IN; C1NH; HAE1; HAE2; C1INH
NCBI Protein Information
plasma protease C1 inhibitor
UniProt Protein Name
Plasma protease C1 inhibitor
UniProt Gene Name
SERPING1
UniProt Synonym Gene Names
C1IN; C1NH; C1 Inh; C1Inh
UniProt Entry Name
IC1_HUMAN

NCBI Description

This gene encodes a highly glycosylated plasma protein involved in the regulation of the complement cascade. Its protein inhibits activated C1r and C1s of the first complement component and thus regulates complement activation. Deficiency of this protein is associated with hereditary angioneurotic oedema (HANE). Alternative splicing results in multiple transcript variants encoding the same isoform. [provided by RefSeq, Jul 2008]

Uniprot Description

SERPING1: a protein protease inhibitor (C1-inhibitor) that forms a proteolytically inactive stoichiometric complex with the C1r or C1s proteases. May play an important role in regulating complement activation, blood coagulation, fibrinolysis and the generation of kinins. Very efficient inhibitor of FXIIa. Mutations of the SERPING1 gene is associated with adult macular degeneration can also cause hereditary angioedema. Binds to E.coli stcE which allows localization of SERPING1 to cell membranes thus protecting the bacteria against complement-mediated lysis. Belongs to the serpin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: extracellular space; extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding

Biological Process: negative regulation of complement activation, lectin pathway; platelet activation; fibrinolysis; platelet degranulation; blood circulation; innate immune response; blood coagulation; blood coagulation, intrinsic pathway; complement activation, classical pathway; aging

Disease: Complement Component 4, Partial Deficiency Of; Angioedema, Hereditary, Type I

Research Articles on SERPING1

Similar Products

Product Notes

The SERPING1 serping1 (Catalog #AAA3220778) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPING1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPING1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPING1 serping1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSNPNATSSS SQDPESLQDR GEGKVATTVI SKMLFVEPIL EVSSLPTTNS. It is sometimes possible for the material contained within the vial of "SERPING1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.