Rabbit anti-Mouse, Rat SERPINB4 Polyclonal Antibody | anti-SERPINB4 antibody
SERPINB4 Polyclonal Antibody
Gene Names
SERPINB4; PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
SERPINB4; Polyclonal Antibody; SERPINB4 Polyclonal Antibody; LEUPIN; PI11; SCCA-2; SCCA1; SCCA2; anti-SERPINB4 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RTMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTNEEFCCNHPFLFFIRQNKTNSILFYGRFSSP
Sequence Length
390
Applicable Applications for anti-SERPINB4 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
A synthetic peptide of human SERPINB4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-SERPINB4 antibody
The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation.
Product Categories/Family for anti-SERPINB4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44kDa
NCBI Official Full Name
serpin B4 isoform 1
NCBI Official Synonym Full Names
serpin family B member 4
NCBI Official Symbol
SERPINB4
NCBI Official Synonym Symbols
PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
NCBI Protein Information
serpin B4
UniProt Protein Name
Serpin B4
Protein Family
UniProt Gene Name
SERPINB4
UniProt Synonym Gene Names
PI11; SCCA2; PI-11; SCCA-2
NCBI Description
The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017]
Uniprot Description
May act as a protease inhibitor to modulate the host immune response against tumor cells.
Research Articles on SERPINB4
Similar Products
Product Notes
The SERPINB4 serpinb4 (Catalog #AAA9135302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB4 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the SERPINB4 serpinb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RTMGMVNIFN GDADLSGMTW SHGLSVSKVL HKAFVEVTEE GVEAAAATAV VVVELSSPST NEEFCCNHPF LFFIRQNKTN SILFYGRFSS P. It is sometimes possible for the material contained within the vial of "SERPINB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
