Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SERPINA10 rabbit polyclonal antibody. Western Blot analysis of SERPINA10 expression in human kidney.)

Rabbit anti-Human SERPINA10 Polyclonal Antibody | anti-SERPINA10 antibody

SERPINA10 (Protein Z-dependent Protease Inhibitor, PZ-dependent Protease Inhibitor, PZI, Serpin A10, ZPI, UNQ707/PRO1358) (Biotin)

Gene Names
SERPINA10; PZI; ZPI
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SERPINA10; Polyclonal Antibody; SERPINA10 (Protein Z-dependent Protease Inhibitor; PZ-dependent Protease Inhibitor; PZI; Serpin A10; ZPI; UNQ707/PRO1358) (Biotin); anti-SERPINA10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SERPINA10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SERPINA10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SERPINA10, aa1-444 (NP_057270.1).
Immunogen Sequence
MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SERPINA10 rabbit polyclonal antibody. Western Blot analysis of SERPINA10 expression in human kidney.)

Western Blot (WB) (SERPINA10 rabbit polyclonal antibody. Western Blot analysis of SERPINA10 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of SERPINA10 expression in transfected 293T cell line by SERPINA10 polyclonal antibody. Lane 1: SERPINA10 transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SERPINA10 expression in transfected 293T cell line by SERPINA10 polyclonal antibody. Lane 1: SERPINA10 transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SERPINA10 antibody
Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids.
Product Categories/Family for anti-SERPINA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,707 Da
NCBI Official Full Name
protein Z-dependent protease inhibitor
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
NCBI Official Symbol
SERPINA10
NCBI Official Synonym Symbols
PZI; ZPI
NCBI Protein Information
protein Z-dependent protease inhibitor; serpin A10; PZ-dependent protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10
UniProt Protein Name
Protein Z-dependent protease inhibitor
UniProt Gene Name
SERPINA10
UniProt Synonym Gene Names
ZPI; PZ-dependent protease inhibitor; PZI
UniProt Entry Name
ZPI_HUMAN

NCBI Description

The protein encoded by this gene belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, May 2010]

Uniprot Description

SERPINA10: Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Belongs to the serpin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 14q32.13

Cellular Component: extracellular space

Molecular Function: heparin binding; serine-type endopeptidase inhibitor activity

Biological Process: regulation of acrosome reaction; blood coagulation

Research Articles on SERPINA10

Similar Products

Product Notes

The SERPINA10 serpina10 (Catalog #AAA6393686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINA10 (Protein Z-dependent Protease Inhibitor, PZ-dependent Protease Inhibitor, PZI, Serpin A10, ZPI, UNQ707/PRO1358) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINA10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SERPINA10 serpina10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SERPINA10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.