Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SEPT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit SEPT1 Polyclonal Antibody | anti-SEPT1 antibody

SEPT1 Antibody - N-terminal region

Gene Names
SEPT1; LARP; SEP1; DIFF6; PNUTL3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEPT1; Polyclonal Antibody; SEPT1 Antibody - N-terminal region; anti-SEPT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFIS
Sequence Length
367
Applicable Applications for anti-SEPT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SEPT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-SEPT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-SEPT1 antibody
This is a rabbit polyclonal antibody against SEPT1. It was validated on Western Blot

Target Description: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease.
Product Categories/Family for anti-SEPT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
septin-1
NCBI Official Synonym Full Names
septin 1
NCBI Official Symbol
SEPT1
NCBI Official Synonym Symbols
LARP; SEP1; DIFF6; PNUTL3
NCBI Protein Information
septin-1
UniProt Protein Name
Septin-1
UniProt Gene Name
SEPT1
UniProt Synonym Gene Names
DIFF6; PNUTL3
UniProt Entry Name
SEPT1_HUMAN

NCBI Description

This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. Alternatively spliced transcript variants have been found but the full-length nature of these variants has not been determined. [provided by RefSeq, Dec 2012]

Uniprot Description

SEPT1: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). Belongs to the septin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Cytoskeletal; Hydrolase

Chromosomal Location of Human Ortholog: 16p11.1

Cellular Component: cytoplasm; microtubule organizing center; midbody

Molecular Function: protein binding; GTP binding

Biological Process: cell division; cell cycle

Research Articles on SEPT1

Similar Products

Product Notes

The SEPT1 sept1 (Catalog #AAA3214559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEPT1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEPT1 sept1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGDSVDCSDC WLPVVKFIEE QFEQYLRDES GLNRKNIQDS RVHCCLYFIS. It is sometimes possible for the material contained within the vial of "SEPT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.