Western Blot (WB)
(Host: RabbitTarget Name: Senp6Antibody Dilution: 1.0ug/mlSample Type: Mouse Lung)
Rabbit Senp6 Polyclonal Antibody | anti-SENP6 antibody
Senp6 antibody - C-terminal region
Gene Names
Senp6; Susp1; mKIAA0797; 2810017C20Rik; E130319N12Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Senp6; Polyclonal Antibody; Senp6 antibody - C-terminal region; anti-SENP6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS
Sequence Length
1132
Applicable Applications for anti-SENP6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Senp6Antibody Dilution: 1.0ug/mlSample Type: Mouse Lung)
Western Blot (WB)
(Host: RabbitTarget Name: Senp6Antibody Dilution: 1.0ug/mlSample Type: Mouse Lung)
Related Product Information for anti-SENP6 antibody
This is a rabbit polyclonal antibody against Senp6. It was validated on Western Blot
Target Description: Senp6 is a protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Senp6 rocesses preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Senp6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. Senp6 is involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Senp6 desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation and desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination.
Target Description: Senp6 is a protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Senp6 rocesses preferentially poly-SUMO2 and poly-SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Senp6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. Senp6 is involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Senp6 desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation and desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination.
Product Categories/Family for anti-SENP6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127kDa
NCBI Official Full Name
sentrin-specific protease 6 isoform 2
NCBI Official Synonym Full Names
SUMO/sentrin specific peptidase 6
NCBI Official Symbol
Senp6
NCBI Official Synonym Symbols
Susp1; mKIAA0797; 2810017C20Rik; E130319N12Rik
NCBI Protein Information
sentrin-specific protease 6
UniProt Protein Name
Sentrin-specific protease 6
Protein Family
UniProt Gene Name
Senp6
UniProt Synonym Gene Names
Kiaa0797; Susp1
UniProt Entry Name
SENP6_MOUSE
Research Articles on SENP6
Similar Products
Product Notes
The SENP6 senp6 (Catalog #AAA3210002) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Senp6 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Senp6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SENP6 senp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAVVCFPGLE KPKYEPNPHY HENAVMQKTP SAEDSCVSSA SEMGACSQNS. It is sometimes possible for the material contained within the vial of "Senp6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
