Rabbit SEMA4A Polyclonal Antibody | anti-SEMA4A antibody

SEMA4A Rabbit pAb

Cat. Num. AAA9142659

• Gene Names: SEMA4A; RP35; SEMB; SEMAB; CORD10; RP11-54H19.2
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity purification
• Synonyms: SEMA4A; Polyclonal Antibody; SEMA4A Rabbit pAb; CORD10; RP35; SEMAB; SEMB; anti-SEMA4A antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: IYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSDKALTFMKDHFLMDEQVVGTPLLVKSGVEYTRLAVETAQGLDGHSHLVMYLGTTTGSLHKAVVSGDSSAHLVEEIQLFPDPEPVRNLQLAPTQGAVFVGFSGGVWRVPRANCSVYESCVDCVLARDPHCAWDPESRTCCLLSAPNLNSWKQDMERGNPEWACASGPMSRSLRPQSRPQIIKEVLAVPNSILELPC

• Applicable Applications for anti-SEMA4A antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IF: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 320-580 of human SEMA4A (NP_071762.2).
• Positive Samples: HT-29
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of HT-29 cells, using SEMA4A Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunofluorescence (IF)

(Immunofluorescence analysis of C6 cells using SEMA4A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of L929 cells using SEMA4A antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Related Product Information for anti-SEMA4A antibody

Background: This gene encodes a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in numerous functions, including axon guidance, morphogenesis, carcinogenesis, and immunomodulation. The encoded protein is a single-pass type I membrane protein containing an immunoglobulin-like C2-type domain, a PSI domain and a sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is an activator of T-cell-mediated immunity and suppresses vascular endothelial growth factor (VEGF)-mediated endothelial cell migration and proliferation in vitro and angiogenesis in vivo. Mutations in this gene are associated with retinal degenerative diseases including retinitis pigmentosa type 35 (RP35) and cone-rod dystrophy type 10 (CORD10). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 300863072
• NCBI GeneID: 64218
• NCBI Accession #: NP_001180229.1
• NCBI GenBank Nucleotide #: NM_001193300.1
• UniProt Accession #: Q9H3S1; Q5TCI5; Q5TCJ6; Q8WUA9; B2RDH8; B3KR76
• Molecular Weight: 83,574 Da
• NCBI Official Full Name: semaphorin-4A isoform 1
• NCBI Official Synonym Full Names: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
• NCBI Official Symbol: SEMA4A
• NCBI Official Synonym Symbols: RP35; SEMB; SEMAB; CORD10; RP11-54H19.2
• NCBI Protein Information: semaphorin-4A; sema B; semaphorin-B
• UniProt Protein Name: Semaphorin-4A
• Protein Family: Semaphorin
• UniProt Gene Name: SEMA4A
• UniProt Synonym Gene Names: SEMAB; SEMB; Sema B
• UniProt Entry Name: SEM4A_HUMAN

NCBI Description

This gene encodes a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in numerous functions, including axon guidance, morphogenesis, carcinogenesis, and immunomodulation. The encoded protein is a single-pass type I membrane protein containing an immunoglobulin-like C2-type domain, a PSI domain and a sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is an activator of T-cell-mediated immunity and suppresses vascular endothelial growth factor (VEGF)-mediated endothelial cell migration and proliferation in vitro and angiogenesis in vivo. Mutations in this gene are associated with retinal degenerative diseases including retinitis pigmentosa type 35 (RP35) and cone-rod dystrophy type 10 (CORD10). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]

Uniprot Description

SEMA4A: a single-pass type I membrane protein that inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. Defects in SEMA4A are the cause of retinitis pigmentosa type 35 and cone-rod dystrophy type 10.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: regulation of cell shape; axon guidance; negative regulation of angiogenesis; T-helper 1 cell differentiation; angiogenesis

Disease: Retinitis Pigmentosa 35; Cone-rod Dystrophy 10