Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SELE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateSELE is supported by BioGPS gene expression data to be expressed in A549)

Rabbit SELE Polyclonal Antibody | anti-SELE antibody

SELE antibody - N-terminal region

Gene Names
SELE; ELAM; ESEL; CD62E; ELAM1; LECAM2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SELE; Polyclonal Antibody; SELE antibody - N-terminal region; anti-SELE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC
Sequence Length
610
Applicable Applications for anti-SELE antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SELE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SELE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateSELE is supported by BioGPS gene expression data to be expressed in A549)

Western Blot (WB) (WB Suggested Anti-SELE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysateSELE is supported by BioGPS gene expression data to be expressed in A549)
Related Product Information for anti-SELE antibody
This is a rabbit polyclonal antibody against SELE. It was validated on Western Blot

Target Description: The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
E-selectin
NCBI Official Synonym Full Names
selectin E
NCBI Official Symbol
SELE
NCBI Official Synonym Symbols
ELAM; ESEL; CD62E; ELAM1; LECAM2
NCBI Protein Information
E-selectin
UniProt Protein Name
E-selectin
Protein Family
UniProt Gene Name
SELE
UniProt Synonym Gene Names
ELAM1; ELAM-1; LECAM2
UniProt Entry Name
LYAM2_HUMAN

NCBI Description

The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008]

Uniprot Description

SELE: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Belongs to the selectin/LECAM family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22-q25

Cellular Component: cortical cytoskeleton; extracellular space; perinuclear region of cytoplasm; integral to membrane; plasma membrane; coated pit; caveola; lipid raft

Molecular Function: protein binding; phospholipase binding; transmembrane receptor activity; sialic acid binding

Biological Process: heterophilic cell adhesion; leukocyte adhesion; phospholipase C activation; positive regulation of leukocyte migration; actin filament-based process; positive regulation of receptor internalization; regulation of inflammatory response; calcium-mediated signaling; response to lipopolysaccharide; blood coagulation; leukocyte tethering or rolling; inflammatory response; leukocyte migration; leukocyte migration during inflammatory response

Disease: Hypertension, Essential

Research Articles on SELE

Similar Products

Product Notes

The SELE sele (Catalog #AAA3214187) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SELE antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SELE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SELE sele for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WVWVGTQKPL TEEAKNWAPG EPNNRQKDED CVEIYIKREK DVGMWNDERC. It is sometimes possible for the material contained within the vial of "SELE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.