Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SEC61B expression in transfected 293T cell line by SEC61B polyclonal antibody. Lane 1: SEC61B transfected lysate (10kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SEC61B Polyclonal Antibody | anti-SEC61B antibody

SEC61B (Protein Transport Protein Sec61 Subunit beta) APC

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SEC61B; Polyclonal Antibody; SEC61B (Protein Transport Protein Sec61 Subunit beta) APC; anti-SEC61B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SEC61B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SEC61B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SEC61B, aa1-96 (NP_006799.1).
Immunogen Sequence
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SEC61B expression in transfected 293T cell line by SEC61B polyclonal antibody. Lane 1: SEC61B transfected lysate (10kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SEC61B expression in transfected 293T cell line by SEC61B polyclonal antibody. Lane 1: SEC61B transfected lysate (10kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SEC61B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,974 Da
NCBI Official Full Name
protein transport protein Sec61 subunit beta
NCBI Official Synonym Full Names
Sec61 beta subunit
NCBI Official Symbol
SEC61B
NCBI Protein Information
protein transport protein Sec61 subunit beta; Sec61 complex, beta subunit; protein translocation complex beta; protein transport protein SEC61 beta subunit
UniProt Protein Name
Protein transport protein Sec61 subunit beta
Protein Family
UniProt Gene Name
SEC61B
UniProt Entry Name
SC61B_HUMAN

NCBI Description

The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq, Jul 2008]

Uniprot Description

SEC61B: Necessary for protein translocation in the endoplasmic reticulum. Belongs to the SEC61-beta family.

Protein type: Endoplasmic reticulum; Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q22.33

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; epidermal growth factor binding

Biological Process: retrograde protein transport, ER to cytosol; SRP-dependent cotranslational protein targeting to membrane; antigen processing and presentation of peptide antigen via MHC class I; ER-associated protein catabolic process; cellular protein metabolic process; translation; protein import into nucleus, translocation; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression

Research Articles on SEC61B

Similar Products

Product Notes

The SEC61B sec61b (Catalog #AAA6393531) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC61B (Protein Transport Protein Sec61 Subunit beta) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC61B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEC61B sec61b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SEC61B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.