Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SEC22BSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SEC22B Polyclonal Antibody | anti-SEC22B antibody

SEC22B Antibody - N-terminal region

Gene Names
SEC22B; ERS-24; SEC22L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SEC22B; Polyclonal Antibody; SEC22B Antibody - N-terminal region; anti-SEC22B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTL
Sequence Length
215
Applicable Applications for anti-SEC22B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEC22B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SEC22BSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SEC22BSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SEC22B antibody
The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.
Product Categories/Family for anti-SEC22B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
vesicle-trafficking protein SEC22b
NCBI Official Synonym Full Names
SEC22 homolog B, vesicle trafficking protein (gene/pseudogene)
NCBI Official Symbol
SEC22B
NCBI Official Synonym Symbols
ERS-24; SEC22L1
NCBI Protein Information
vesicle-trafficking protein SEC22b
UniProt Protein Name
Vesicle-trafficking protein SEC22b
UniProt Gene Name
SEC22B
UniProt Synonym Gene Names
SEC22L1; ERS-24; ERS24
UniProt Entry Name
SC22B_HUMAN

NCBI Description

The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

SEC22B: SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER. Belongs to the synaptobrevin family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.1

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; ER-Golgi intermediate compartment membrane; integral to membrane; ER-Golgi intermediate compartment; melanosome

Molecular Function: protein binding; syntaxin binding

Biological Process: ER to Golgi vesicle-mediated transport; protein transport; positive regulation of protein catabolic process; regulation of organelle organization and biogenesis

Research Articles on SEC22B

Similar Products

Product Notes

The SEC22B sec22b (Catalog #AAA3221858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEC22B Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEC22B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEC22B sec22b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMIARVADGL PLAASMQEDE QSGRDLQQYQ SQAKQLFRKL NEQSPTRCTL. It is sometimes possible for the material contained within the vial of "SEC22B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.