Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SAR1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Rabbit SAR1B Polyclonal Antibody | anti-SAR1B antibody

SAR1B antibody - middle region

Gene Names
SAR1B; ANDD; CMRD; GTBPB; SARA2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAR1B; Polyclonal Antibody; SAR1B antibody - middle region; anti-SAR1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
Sequence Length
198
Applicable Applications for anti-SAR1B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SAR1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-SAR1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-SAR1B antibody
This is a rabbit polyclonal antibody against SAR1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
GTP-binding protein SAR1b
NCBI Official Synonym Full Names
secretion associated Ras related GTPase 1B
NCBI Official Symbol
SAR1B
NCBI Official Synonym Symbols
ANDD; CMRD; GTBPB; SARA2
NCBI Protein Information
GTP-binding protein SAR1b
UniProt Protein Name
GTP-binding protein SAR1b
Protein Family
UniProt Gene Name
SAR1B
UniProt Synonym Gene Names
SARA2; SARB; GTBPB
UniProt Entry Name
SAR1B_HUMAN

NCBI Description

The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

SAR1B: Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Activated by the guanine nucleotide exchange factor PREB. Involved in the selection of the protein cargo and the assembly of the COPII coat complex. Defects in SAR1B are the cause of chylomicron retention disease (CMRD); also known as Anderson disease (ANDD). CMRD is an autosomal recessive disorder of severe fat malabsorption associated with failure to thrive in infancy. The condition is characterized by deficiency of fat-soluble vitamins, low blood cholesterol levels, and a selective absence of chylomicrons from blood. Affected individuals accumulate chylomicron-like particles in membrane-bound compartments of enterocytes, which contain large cytosolic lipid droplets. Belongs to the small GTPase superfamily. SAR1 family.

Protein type: G protein, monomeric; G protein; G protein, monomeric, SAR1; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: endoplasmic reticulum membrane; cytosol

Molecular Function: GTPase activity; GTP binding; metal ion binding

Biological Process: COPII coating of Golgi vesicle; intracellular protein transport; ER to Golgi vesicle-mediated transport; antigen processing and presentation of peptide antigen via MHC class I; cellular protein metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class II; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Disease: Chylomicron Retention Disease

Research Articles on SAR1B

Similar Products

Product Notes

The SAR1B sar1b (Catalog #AAA3212652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAR1B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SAR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAR1B sar1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLLESKEELD SLMTDETIAN VPILILGNKI DRPEAISEER LREMFGLYGQ. It is sometimes possible for the material contained within the vial of "SAR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.