Rabbit anti-Human SAP30 Polyclonal Antibody | anti-SAP30 antibody

SAP30 (Sin3-associated Polypeptide p30, 30kD Sin3-associated Polypeptide, Histone Deacetylase Complex Subunit SAP30, Sin3 Corepressor Complex Subunit SAP30) (FITC)

Cat. Num. AAA6393269

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAP30; Polyclonal Antibody; SAP30 (Sin3-associated Polypeptide p30; 30kD Sin3-associated Polypeptide; Histone Deacetylase Complex Subunit SAP30; Sin3 Corepressor Complex Subunit SAP30) (FITC); anti-SAP30 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SAP30.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-SAP30 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SAP30, aa1-220 (NP_003855.1).
• Immunogen Sequence: MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAVSAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKIELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGVH
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SAP30 expression in transfected 293T cell line by SAP30 polyclonal antibody. Lane 1: SAP30 transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-SAP30 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4506783
• NCBI GeneID: 8819
• NCBI Accession #: NP_003855.1
• NCBI GenBank Nucleotide #: NM_003864.3
• UniProt Accession #: O75446; D3DP38
• Molecular Weight: 23,306 Da
• NCBI Official Full Name: histone deacetylase complex subunit SAP30
• NCBI Official Synonym Full Names: Sin3A-associated protein, 30kDa
• NCBI Official Symbol: SAP30
• NCBI Protein Information: histone deacetylase complex subunit SAP30; sin3-associated polypeptide p30; 30 kDa Sin3-associated polypeptide; Sin3-associated polypeptide, 30kDa; sin3-associated polypeptide, 30 kDa; Sin3 corepressor complex subunit SAP30
• UniProt Protein Name: Histone deacetylase complex subunit SAP30
• Protein Family: SAP30-binding protein
• UniProt Gene Name: SAP30
• UniProt Entry Name: SAP30_HUMAN

Uniprot Description

SAP30: Involved in the functional recruitment of the Sin3- histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N- CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones. Belongs to the SAP30 family.

Protein type: Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 4q34.1

Cellular Component: nucleoplasm; histone deacetylase complex

Molecular Function: protein binding; DNA binding; metal ion binding; transcription corepressor activity

Biological Process: establishment and/or maintenance of chromatin architecture; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of gene expression, epigenetic; gene expression; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic