Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of SAP18 transfected lysate using SAP18 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAP18 purified mouse polyclonal antibody.)

Rabbit anti-Human SAP18 Polyclonal Antibody | anti-SAP18 antibody

SAP18 (Histone Deacetylase Complex Subunit SAP18, 18kD Sin3-associated Polypeptide, 2HOR0202, Cell Growth-inhibiting Gene 38 Protein, Sin3-associated Polypeptide p18)

Gene Names
SAP18; SAP18P; 2HOR0202
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
SAP18; Polyclonal Antibody; SAP18 (Histone Deacetylase Complex Subunit SAP18; 18kD Sin3-associated Polypeptide; 2HOR0202; Cell Growth-inhibiting Gene 38 Protein; Sin3-associated Polypeptide p18); Anti -SAP18 (Histone Deacetylase Complex Subunit SAP18; anti-SAP18 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SAP18.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
Applicable Applications for anti-SAP18 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full-length human SAP18, aa1-153 (NP_005861.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of SAP18 transfected lysate using SAP18 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAP18 purified mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SAP18 transfected lysate using SAP18 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SAP18 purified mouse polyclonal antibody.)
Related Product Information for anti-SAP18 antibody
Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2.
Product Categories/Family for anti-SAP18 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17,561 Da
NCBI Official Full Name
SAP18
NCBI Official Synonym Full Names
Sin3A-associated protein, 18kDa
NCBI Official Symbol
SAP18
NCBI Official Synonym Symbols
SAP18P; 2HOR0202
NCBI Protein Information
histone deacetylase complex subunit SAP18; sin3-associated polypeptide p18; sin3-associated polypeptide, p18; cell growth inhibiting protein 38; cell growth-inhibiting protein 38; 18 kDa Sin3-associated polypeptide; sin3-associated polypeptide, 18 kDa; cell growth-inhibiting gene 38 protein; histone deacetlyase complex subunit SAP18
UniProt Protein Name
Histone deacetylase complex subunit SAP18
UniProt Gene Name
SAP18
UniProt Entry Name
SAP18_HUMAN

NCBI Description

Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2008]

Uniprot Description

SAP18: Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Belongs to the SAP18 family.

Chromosomal Location of Human Ortholog: 13q12.11

Cellular Component: nucleoplasm; cytoplasm; histone deacetylase complex; nuclear speck

Molecular Function: protein binding; transcription corepressor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; negative regulation of nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; positive regulation of apoptosis; negative regulation of gene expression, epigenetic; RNA splicing; gene expression; mRNA processing; regulation of gene expression, epigenetic; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on SAP18

Similar Products

Product Notes

The SAP18 sap18 (Catalog #AAA642064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAP18 (Histone Deacetylase Complex Subunit SAP18, 18kD Sin3-associated Polypeptide, 2HOR0202, Cell Growth-inhibiting Gene 38 Protein, Sin3-associated Polypeptide p18) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAP18 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the SAP18 sap18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAVESRVTQE EIKKEPEKPI DREKTCPLLL RVFTTNNGRH HRMDEFSRGN VPSSELQIYT WMDATLKELT SLVKEVYPEA RKKGTHFNFA IVFTDVKRPG YRVKEIGSTM SGRKGTDDSM TLQSQKFQIG DYLDIAITPP NRAPPPSGRM RPY. It is sometimes possible for the material contained within the vial of "SAP18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.