Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SACM1LSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SACM1L Polyclonal Antibody | anti-SACM1L antibody

SACM1L Antibody - N-terminal region

Gene Names
SACM1L; SAC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SACM1L; Polyclonal Antibody; SACM1L Antibody - N-terminal region; anti-SACM1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVL
Sequence Length
287
Applicable Applications for anti-SACM1L antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human SACM1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SACM1LSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SACM1LSample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SACM1L antibody
This is a rabbit polyclonal antibody against SACM1L. It was validated on Western Blot

Target Description: This gene encodes an integral membrane protein that is localized to the endoplasmic reticulum and golgi, and functions as a phosphoinositide lipid phosphatase. Studies in mammals suggest that this gene is involved in the organization of golgi membranes and the mitotic spindles. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-SACM1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
phosphatidylinositide phosphatase SAC1 isoform 1
NCBI Official Synonym Full Names
SAC1 like phosphatidylinositide phosphatase
NCBI Official Symbol
SACM1L
NCBI Official Synonym Symbols
SAC1
NCBI Protein Information
phosphatidylinositide phosphatase SAC1
UniProt Protein Name
Phosphatidylinositide phosphatase SAC1
UniProt Gene Name
SACM1L
UniProt Entry Name
SAC1_HUMAN

NCBI Description

This gene encodes an integral membrane protein, which is localized to the endoplasmic reticulum, and functions as a phosphoinositide phosphatase that hydrolyzes phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, and phosphatidylinositol 3,5-bisphosphate. Deletion of this gene in mouse results in preimplantation lethality. Other studies suggest that this gene is also involved in the organization of golgi membranes and mitotic spindles. Alternatively spliced transcript variants have been found for this gene. A C-terminally extended isoform is also predicted to be produced by the use of an alternative in-frame, downstream translation termination codon via a stop codon readthrough mechanism.[provided by RefSeq, Dec 2017]

Uniprot Description

SACM1L: Phosphoinositide phosphatase that hydrolyzes PtdIns(3)P and PtdIns(4)P. Has low activity towards PtdIns(3,5)P2.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; EC 3.1.3.-; Phosphatase, lipid; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: endoplasmic reticulum membrane; Golgi apparatus; Golgi membrane; integral to endoplasmic reticulum membrane

Molecular Function: phosphatidylinositol-3-phosphatase activity; phosphatidylinositol-4-phosphate phosphatase activity; phosphoric monoester hydrolase activity; protein binding

Biological Process: phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation; phospholipid metabolic process

Research Articles on SACM1L

Similar Products

Product Notes

The SACM1L sacm1l (Catalog #AAA3208395) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SACM1L Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SACM1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SACM1L sacm1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HTLQRLSNTS PEFQEMSLLE RADQRFVWNG HLLRELSAQP EVHRFALPVL. It is sometimes possible for the material contained within the vial of "SACM1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.