Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: S100A9Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit S100A9 Polyclonal Antibody | anti-S100A9 antibody

S100A9 Antibody - middle region

Gene Names
S100A9; MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
S100A9; Polyclonal Antibody; S100A9 Antibody - middle region; anti-S100A9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEK
Sequence Length
114
Applicable Applications for anti-S100A9 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human S100A9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: S100A9Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: S100A9Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-S100A9 antibody
This is a rabbit polyclonal antibody against S100A9. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
protein S100-A9
NCBI Official Synonym Full Names
S100 calcium binding protein A9
NCBI Official Symbol
S100A9
NCBI Official Synonym Symbols
MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
NCBI Protein Information
protein S100-A9
UniProt Protein Name
Protein S100-A9
Protein Family
UniProt Gene Name
S100A9
UniProt Synonym Gene Names
CAGB; CFAG; MRP14; MRP-14; p14
UniProt Entry Name
S10A9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]

Uniprot Description

S100A9: a calcium-binding regulatory protein of the S-100 family expressed by macrophages in acutely inflammated tissues and in chronic inflammations. May be an inhibitor of protein kinases. Also expressed in epithelial cells constitutively or induced during dermatoses. May interact with components of the intermediate filaments in monocytes and epithelial cells. Interacts with CEACAM3 in a calcium-dependent manner.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; cytoskeleton; plasma membrane; extracellular region; cytosol; nucleus

Molecular Function: arachidonic acid binding; antioxidant activity; signal transducer activity; protein binding; RAGE receptor binding; zinc ion binding; microtubule binding; calcium ion binding

Biological Process: caspase activation; neutrophil chemotaxis; chemokine production; chronic inflammatory response; cytokine production; response to lipopolysaccharide; positive regulation of peptide secretion; signal transduction; positive regulation of cell growth; leukocyte migration during inflammatory response; activation of NF-kappaB transcription factor; sequestering of zinc ion; response to ethanol; cell-cell signaling; response to zinc ion; actin cytoskeleton reorganization; defense response to bacterium; autophagy; innate immune response; regulation of integrin biosynthetic process; inflammatory response; defense response to fungus; regulation of cytoskeleton organization and biogenesis; positive regulation of inflammatory response

Research Articles on S100A9

Similar Products

Product Notes

The S100A9 s100a9 (Catalog #AAA3212836) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A9 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's S100A9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the S100A9 s100a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLQNFLKKEN KNEKVIEHIM EDLDTNADKQ LSFEEFIMLM ARLTWASHEK. It is sometimes possible for the material contained within the vial of "S100A9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.