Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: S100A11Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human S100A11 Polyclonal Antibody | anti-S100A11 antibody

S100A11 Antibody - N-terminal region

Gene Names
S100A11; MLN70; S100C; HEL-S-43
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
S100A11; Polyclonal Antibody; S100A11 Antibody - N-terminal region; anti-S100A11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN
Sequence Length
105
Applicable Applications for anti-S100A11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human S100A11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: S100A11Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: S100A11Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-S100A11 antibody
This is a rabbit polyclonal antibody against S100A11. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Product Categories/Family for anti-S100A11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
protein S100-A11
NCBI Official Synonym Full Names
S100 calcium binding protein A11
NCBI Official Symbol
S100A11
NCBI Official Synonym Symbols
MLN70; S100C; HEL-S-43
NCBI Protein Information
protein S100-A11
UniProt Protein Name
Protein S100-A11
Protein Family
UniProt Gene Name
S100A11
UniProt Synonym Gene Names
MLN70; S100C; MLN 70
UniProt Entry Name
S10AB_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A11: a calcium-binding regulatory protein of the S-100 family. Interacts with the N-termini of annexins A1. May regulate fusion processes such as endo- and exocytosis. Increases in the early stage of pancreatic carcinogenesis and decreases during subsequent progression to cancer. Increased expression in anaplastic large cell lymphoma.

Protein type: DNA replication; Cell cycle regulation; Calcium-binding

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; ruffle; extracellular space; cytoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; calcium ion binding; calcium-dependent protein binding

Biological Process: negative regulation of cell proliferation; negative regulation of DNA replication; signal transduction

Research Articles on S100A11

Similar Products

Product Notes

The S100A11 s100a11 (Catalog #AAA3219211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S100A11 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100A11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the S100A11 s100a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQKYAGKDGY NYTLSKTEFL SFMNTELAAF TKNQKDPGVL DRMMKKLDTN. It is sometimes possible for the material contained within the vial of "S100A11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.