Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Mouse Skin lysate; Primary Ab: 1ug/ml Rabbit Anti-Human S100A3 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Rabbit anti-Human S100 Calcium Binding Protein A3 (S100A3) Polyclonal Antibody | anti-S100A3 antibody

Polyclonal Antibody to S100 Calcium Binding Protein A3 (S100A3)

Gene Names
S100A3; S100E
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
S100 Calcium Binding Protein A3 (S100A3); Polyclonal Antibody; Polyclonal Antibody to S100 Calcium Binding Protein A3 (S100A3); anti-S100A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against S100A3. It has been selected for its ability to recognize S100A3 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MARPLEQAVA AIVCTFQEYA GRCGDKYKLC QAELKELLQK ELATWTPTEF RECDYNKFMS VLDTNKDCEV DFVEYVRSLA CLCLYCHEYF KDCPSEPPCS Q
Sequence Length
101
Applicable Applications for anti-S100A3 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant S100A3 (Met1~Gln101) expressed in E.coli.
Cross Reactivity
Human, Mouse
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2062081
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Mouse Skin lysate; Primary Ab: 1ug/ml Rabbit Anti-Human S100A3 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB) (Western Blot: Sample: Mouse Skin lysate; Primary Ab: 1ug/ml Rabbit Anti-Human S100A3 Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Immunohistochemistry (IHC)

(DAB staining on fromalin fixed paraffin-embedded kidney tissue))

Immunohistochemistry (IHC) (DAB staining on fromalin fixed paraffin-embedded kidney tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11,713 Da
NCBI Official Full Name
S100 calcium binding protein A3
NCBI Official Synonym Full Names
S100 calcium binding protein A3
NCBI Official Symbol
S100A3
NCBI Official Synonym Symbols
S100E
NCBI Protein Information
protein S100-A3; S100 calcium-binding protein A3
UniProt Protein Name
Protein S100-A3
Protein Family
UniProt Gene Name
S100A3
UniProt Synonym Gene Names
S100E
UniProt Entry Name
S10A3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008]

Uniprot Description

S100A3: Binds both calcium and zinc. Probably binds 2 zinc ions per molecule. May be involved in calcium-dependent cuticle cell differentiation and hair shaft formation. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoplasm; nucleolus

Molecular Function: zinc ion binding; calcium ion binding

Research Articles on S100A3

Similar Products

Product Notes

The S100A3 s100a3 (Catalog #AAA2003744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to S100 Calcium Binding Protein A3 (S100A3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S100 Calcium Binding Protein A3 (S100A3) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the S100A3 s100a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-MARPLEQ AVA AIVCTFQEYA GRCGDKYKLC QAELKELLQK ELATWTPTEF RECDYNKFMS VLDTNKDCEV DFVEYVRSLA CLCLYCHEYF KDCPSEPPCS Q. It is sometimes possible for the material contained within the vial of "S100 Calcium Binding Protein A3 (S100A3), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.