Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RRAGCSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit RRAGC Polyclonal Antibody | anti-RRAGC antibody

RRAGC Antibody - N-terminal region

Gene Names
RRAGC; GTR2; RAGC; TIB929
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RRAGC; Polyclonal Antibody; RRAGC Antibody - N-terminal region; anti-RRAGC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG
Sequence Length
399
Applicable Applications for anti-RRAGC antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RRAGC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RRAGCSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RRAGCSample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RRAGC antibody
This is a rabbit polyclonal antibody against RRAGC. It was validated on Western Blot

Target Description: This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-RRAGC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
ras-related GTP-binding protein C isoform 1
NCBI Official Synonym Full Names
Ras related GTP binding C
NCBI Official Symbol
RRAGC
NCBI Official Synonym Symbols
GTR2; RAGC; TIB929
NCBI Protein Information
ras-related GTP-binding protein C
UniProt Protein Name
Ras-related GTP-binding protein C
UniProt Gene Name
RRAGC
UniProt Synonym Gene Names
Rag C; RagC
UniProt Entry Name
RRAGC_HUMAN

NCBI Description

This gene encodes a member of the GTR/RAG GTP-binding protein family. The encoded protein is a monomeric guanine nucleotide-binding protein which forms a heterodimer with RRAGA and RRAGB and is primarily localized to the cytoplasm. The encoded protein promotes intracellular localization of the mTOR complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]

Uniprot Description

RRAGC: Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid- induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Forms a heterodimer with RRAGA in a sequence-independent manner. Binds GTP. Interacts with NOL8 and RRAGB. Belongs to the GTR/RAG GTP-binding protein family.

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; lysosome; cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; protein heterodimerization activity; magnesium ion binding

Biological Process: transcription, DNA-dependent; apoptosis; RNA splicing; small GTPase mediated signal transduction; regulation of autophagy; cellular response to starvation; cell growth; positive regulation of TOR signaling pathway

Research Articles on RRAGC

Similar Products

Product Notes

The RRAGC rragc (Catalog #AAA3213458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRAGC Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's RRAGC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RRAGC rragc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSLQYGAEET PLAGSYGAAD SFPKDFGYGV EEEEEEAAAA GGGVGAGAGG. It is sometimes possible for the material contained within the vial of "RRAGC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.