Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPS6KA4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit RPS6KA4 Polyclonal Antibody | anti-RPS6KA4 antibody

RPS6KA4 antibody - C-terminal region

Gene Names
RPS6KA4; MSK2; RSK-B; S6K-alpha-4
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPS6KA4; Polyclonal Antibody; RPS6KA4 antibody - C-terminal region; anti-RPS6KA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKREGFFLKSVENAPLAKRRKQKLRSATASRRGSPAPANPGRAPVASKGA
Sequence Length
766
Applicable Applications for anti-RPS6KA4 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 92%; Human: 100%; Mouse: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPS6KA4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-RPS6KA4 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-RPS6KA4 antibody
This is a rabbit polyclonal antibody against RPS6KA4. It was validated on Western Blot

Target Description: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and c-fos. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
ribosomal protein S6 kinase alpha-4 isoform b
NCBI Official Synonym Full Names
ribosomal protein S6 kinase A4
NCBI Official Symbol
RPS6KA4
NCBI Official Synonym Symbols
MSK2; RSK-B; S6K-alpha-4
NCBI Protein Information
ribosomal protein S6 kinase alpha-4
UniProt Protein Name
Ribosomal protein S6 kinase alpha-4
UniProt Gene Name
RPS6KA4
UniProt Synonym Gene Names
MSK2; S6K-alpha-4; RSKB
UniProt Entry Name
KS6A4_HUMAN

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including CREB1 and ATF1. The encoded protein can also phosphorylate histone H3 to regulate certain inflammatory genes. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]

Uniprot Description

MSK2: an AGC kinase of the RSK family. Has two kinase domains connected by a regulatory linker region. Phosphorylates H3 and HMG-14 in response to growth factors and cellular stress.

Protein type: EC 2.7.11.1; Protein kinase, AGC; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); AGC group; RSK family; MSK subfamily

Chromosomal Location of Human Ortholog: 11q11-q13

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; mitogen-activated protein kinase p38 binding; magnesium ion binding; ribosomal protein S6 kinase activity; ATP binding

Biological Process: axon guidance; regulation of transcription, DNA-dependent; positive regulation of histone phosphorylation; histone phosphorylation; negative regulation of cytokine production; activation of CREB transcription factor; positive regulation of histone acetylation; positive regulation of transcription from RNA polymerase II promoter; inflammatory response; protein amino acid phosphorylation; activation of NF-kappaB transcription factor

Research Articles on RPS6KA4

Similar Products

Product Notes

The RPS6KA4 rps6ka4 (Catalog #AAA3215779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPS6KA4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPS6KA4 rps6ka4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKREGFFLKS VENAPLAKRR KQKLRSATAS RRGSPAPANP GRAPVASKGA. It is sometimes possible for the material contained within the vial of "RPS6KA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.