Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-RPL26 Polyclonal Antibody)

Rabbit RPL26 Polyclonal Antibody | anti-RPL26 antibody

RPL26 Polyclonal Antibody

Gene Names
RPL26; L26; DBA11
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RPL26; Polyclonal Antibody; RPL26 Polyclonal Antibody; DBA11; L26; ribosomal protein L26; anti-RPL26 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.58 mg/ml (varies by lot)
Sequence Length
145
Applicable Applications for anti-RPL26 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-95 of human RPL26 (NP_000978.1).
Immunogen Sequence
NAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTV
Positive Samples
K562, HT-29, HeLa, Mouse Liver, Mouse Kidney, Mouse Brain, Rat Thymus, Rat Spleen, Rat Lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RPL26 Polyclonal Antibody)

Western Blot (WB) (Western blot-RPL26 Polyclonal Antibody)
Related Product Information for anti-RPL26 antibody
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 17kDa
Observed: 20kDa
NCBI Official Full Name
60S ribosomal protein L26
NCBI Official Synonym Full Names
ribosomal protein L26
NCBI Official Symbol
RPL26
NCBI Official Synonym Symbols
L26; DBA11
NCBI Protein Information
60S ribosomal protein L26
UniProt Protein Name
60S ribosomal protein L26
Protein Family
UniProt Gene Name
RPL26
UniProt Entry Name
RL26_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Mutations in this gene result in Diamond-Blackfan anemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

RPL26: Belongs to the ribosomal protein L24P family.

Protein type: Translation; Ribosomal

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: membrane; cytosol

Molecular Function: structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translation; viral reproduction; translational termination; ribosomal large subunit biogenesis and assembly; viral infectious cycle; translational elongation; cellular protein metabolic process; translational initiation; mRNA catabolic process, nonsense-mediated decay; viral transcription; gene expression; rRNA processing

Disease: Diamond-blackfan Anemia 11

Research Articles on RPL26

Similar Products

Product Notes

The RPL26 rpl26 (Catalog #AAA9140965) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPL26 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPL26 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RPL26 rpl26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPL26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.