Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human RPA4 Polyclonal Antibody | anti-RPA4 antibody

RPA4 (Replication Protein A4, 34kD, HSU24186, MGC120333, MGC120334) (MaxLight 750)

Gene Names
RPA4; HSU24186
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
RPA4; Polyclonal Antibody; RPA4 (Replication Protein A4; 34kD; HSU24186; MGC120333; MGC120334) (MaxLight 750); Replication Protein A4; MGC120334; anti-RPA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RPA4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-RPA4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RPA4 (NP_037479.1, 1aa-261aa) full-length human protein.
Immunogen Sequence
MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-RPA4 antibody
Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70-and 13-kDa subunits to form a trimeric RPA complex. [provided by RefSeq]
Product Categories/Family for anti-RPA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,868 Da
NCBI Official Full Name
replication protein A 30 kDa subunit
NCBI Official Synonym Full Names
replication protein A4, 30kDa
NCBI Official Symbol
RPA4
NCBI Official Synonym Symbols
HSU24186
NCBI Protein Information
replication protein A 30 kDa subunit; RP-A p30; RF-A protein 4; replication protein A4, 34kDa; replication factor A protein 4; replication protein A complex 34 kd subunit homolog Rpa4
Protein Family

Similar Products

Product Notes

The RPA4 (Catalog #AAA6451573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPA4 (Replication Protein A4, 34kD, HSU24186, MGC120333, MGC120334) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPA4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.