Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RORC rabbit polyclonal antibody. Western Blot analysis of RORC expression in mouse lung.)

Rabbit anti-Human, Mouse RORC Polyclonal Antibody | anti-RORC antibody

RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin)

Gene Names
RORC; TOR; RORG; RZRG; NR1F3; RZR-GAMMA
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RORC; Polyclonal Antibody; RORC (Nuclear Receptor ROR-gamma; Nuclear Receptor RZR-gamma; Nuclear Receptor Subfamily 1 Group F Member 3; Retinoid-related Orphan Receptor-gamma; NR1F3; RORG; RZRG) (Biotin); anti-RORC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RORC. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RORC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RORC, aa1-518 (NP_005051.2).
Immunogen Sequence
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RORC rabbit polyclonal antibody. Western Blot analysis of RORC expression in mouse lung.)

Western Blot (WB) (RORC rabbit polyclonal antibody. Western Blot analysis of RORC expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of RORC expression in transfected 293T cell line by RORC polyclonal antibody. Lane 1: RORC transfected lysate (58.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RORC expression in transfected 293T cell line by RORC polyclonal antibody. Lane 1: RORC transfected lysate (58.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RORC antibody
RORg (Nuclear receptor ROR-gamma) is a member of the NR1 nuclear hormone receptor family. RORg is a DNA binding transcription factor. RORg is 518aa in length. Kockout mice implicate RORg as being essential for lymphoid organogenesis and controlling apoptosis during thymopoiesis. Two splice forms differing in the first 24aa have been found for this gene, isoform 2 deletes aa1-21 resulting in an alteration of aa22-24. Over aa1-100 human RORC shares 96% identity with mouse RORg.
Product Categories/Family for anti-RORC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55,813 Da
NCBI Official Full Name
Homo sapiens RAR-related orphan receptor C (RORC), transcript variant 1, mRNA
NCBI Official Synonym Full Names
RAR-related orphan receptor C
NCBI Official Symbol
RORC
NCBI Official Synonym Symbols
TOR; RORG; RZRG; NR1F3; RZR-GAMMA
NCBI Protein Information
nuclear receptor ROR-gamma; RAR-related orphan nuclear receptor variant 2; RAR-related orphan receptor C, isoform a; nuclear receptor RZR-gamma; nuclear receptor subfamily 1 group F member 3; retinoic acid-binding receptor gamma; retinoid-related orphan r
Protein Family

NCBI Description

The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on RORC

Similar Products

Product Notes

The RORC (Catalog #AAA6392828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RORC (Nuclear Receptor ROR-gamma, Nuclear Receptor RZR-gamma, Nuclear Receptor Subfamily 1 Group F Member 3, Retinoid-related Orphan Receptor-gamma, NR1F3, RORG, RZRG) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RORC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RORC for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RORC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.