Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney)

Rabbit anti-Human RORA Polyclonal Antibody | anti-RORA antibody

RORA antibody - N-terminal region

Gene Names
RORA; ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RORA; Polyclonal Antibody; RORA antibody - N-terminal region; anti-RORA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA
Sequence Length
556
Applicable Applications for anti-RORA antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RORA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney)

Immunohistochemistry (IHC) (Human kidney)

Western Blot (WB)

(WB Suggested Anti-RORA Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RORA Antibody Titration: 4.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-RORA antibody
This is a rabbit polyclonal antibody against RORA. It was validated on Western Blot and immunohistochemistry

Target Description: The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
nuclear receptor ROR-alpha isoform c
NCBI Official Synonym Full Names
RAR related orphan receptor A
NCBI Official Symbol
RORA
NCBI Official Synonym Symbols
ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
NCBI Protein Information
nuclear receptor ROR-alpha
UniProt Protein Name
Nuclear receptor ROR-alpha
Protein Family
UniProt Gene Name
RORA
UniProt Synonym Gene Names
NR1F1; RZRA
UniProt Entry Name
RORA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

RORA iso1: Orphan nuclear receptor. Binds DNA as a monomer to hormone response elements (HRE) containing a single core motif half-site preceded by a short A-T-rich sequence. This isomer binds to the consensus sequence 5'-[AT][TA]A[AT][CGT]TAGGTCA-3'. Regulates a number of genes involved in lipid metabolism such as apolipoproteins AI, APOA5, CIII, CYP71 and PPARgamma, in cerebellum and photoreceptor development including PCP2, OPN1SW, OPN1SM AND ARR3, in circadian rhythm with BMAL1, and skeletal muscle development with MYOD1. Possible receptor for cholesterol or one of its derivatives. Monomer. Interacts (via the DNA-binding domain) with HIF1; the interaction enhances HIF1A transcription under hypoxia through increasing protein stability. By hypoxia and melatonin. Widely expressed in a number of tissues. Activated by CaMK4. Belongs to the nuclear hormone receptor family. NR1 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; DNA binding; zinc ion binding; sequence-specific DNA binding; beta-catenin binding; oxysterol binding; steroid hormone receptor activity; transcription factor activity; transcription factor binding

Biological Process: circadian rhythm; transcription initiation from RNA polymerase II promoter; granule cell precursor proliferation; intracellular receptor-mediated signaling pathway; regulation of macrophage activation; positive regulation of transcription, DNA-dependent; negative regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of circadian rhythm; negative regulation of fat cell differentiation; muscle cell differentiation; regulation of transcription, DNA-dependent; negative regulation of inflammatory response; xenobiotic metabolic process; regulation of steroid metabolic process; cerebellar Purkinje cell differentiation; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; angiogenesis; circadian regulation of gene expression; nitric oxide biosynthetic process; cGMP metabolic process; regulation of smoothened signaling pathway

Research Articles on RORA

Similar Products

Product Notes

The RORA rora (Catalog #AAA3224597) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RORA antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RORA can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RORA rora for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGILQILHQC ILSSGDAFVL TGVCCSWRQN GKPPYSQKED KEVQTGYMNA. It is sometimes possible for the material contained within the vial of "RORA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.