Rabbit RNMT Polyclonal Antibody | anti-RNMT antibody
RNMT antibody - N-terminal region
Gene Names
RNMT; MET; Met; CMT1; cm1p; hMet; CMT1c; hCMT1; RG7MT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNMT; Polyclonal Antibody; RNMT antibody - N-terminal region; anti-RNMT antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
Sequence Length
476
Applicable Applications for anti-RNMT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RNMT antibody
This is a rabbit polyclonal antibody against RNMT. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
Target Description: RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
Product Categories/Family for anti-RNMT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
mRNA cap guanine-N7 methyltransferase isoform 2
NCBI Official Synonym Full Names
RNA guanine-7 methyltransferase
NCBI Official Symbol
RNMT
NCBI Official Synonym Symbols
MET; Met; CMT1; cm1p; hMet; CMT1c; hCMT1; RG7MT1
NCBI Protein Information
mRNA cap guanine-N7 methyltransferase
UniProt Protein Name
mRNA cap guanine-N7 methyltransferase
Protein Family
UniProt Gene Name
RNMT
UniProt Synonym Gene Names
KIAA0398; hCMT1; hMet; hcm1p
UniProt Entry Name
MCES_HUMAN
Uniprot Description
RNMT: mRNA capping methyltransferase that methylates the N7 position of the added guanosine to the 5' cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC. Interacts with importin alpha, leading to stimulate both RNA-binding and methyltransferase activity. Interaction with importin alpha and beta is required for its nuclear localization, importin beta dissociating in response to RanGTP, allowing RNMT- importin alpha to bind RNA substrates.Interacts with elongating form of polymerase II and RNGTT. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Methyltransferase; RNA processing; EC 2.1.1.56
Chromosomal Location of Human Ortholog: 18p11.21
Cellular Component: nucleoplasm; mRNA cap complex; nucleolus; nucleus; receptor complex
Molecular Function: protein binding; RNA binding; mRNA (guanine-N7-)-methyltransferase activity
Biological Process: transcription from RNA polymerase II promoter; mRNA capping; viral reproduction; gene expression
