Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit RNMT Polyclonal Antibody | anti-RNMT antibody

RNMT antibody - N-terminal region

Gene Names
RNMT; MET; Met; CMT1; cm1p; hMet; CMT1c; hCMT1; RG7MT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNMT; Polyclonal Antibody; RNMT antibody - N-terminal region; anti-RNMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
Sequence Length
476
Applicable Applications for anti-RNMT antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RNMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-RNMT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-RNMT antibody
This is a rabbit polyclonal antibody against RNMT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
Product Categories/Family for anti-RNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
mRNA cap guanine-N7 methyltransferase isoform 2
NCBI Official Synonym Full Names
RNA guanine-7 methyltransferase
NCBI Official Symbol
RNMT
NCBI Official Synonym Symbols
MET; Met; CMT1; cm1p; hMet; CMT1c; hCMT1; RG7MT1
NCBI Protein Information
mRNA cap guanine-N7 methyltransferase
UniProt Protein Name
mRNA cap guanine-N7 methyltransferase
UniProt Gene Name
RNMT
UniProt Synonym Gene Names
KIAA0398; hCMT1; hMet; hcm1p
UniProt Entry Name
MCES_HUMAN

Uniprot Description

RNMT: mRNA capping methyltransferase that methylates the N7 position of the added guanosine to the 5' cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC. Interacts with importin alpha, leading to stimulate both RNA-binding and methyltransferase activity. Interaction with importin alpha and beta is required for its nuclear localization, importin beta dissociating in response to RanGTP, allowing RNMT- importin alpha to bind RNA substrates.Interacts with elongating form of polymerase II and RNGTT. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Methyltransferase; RNA processing; EC 2.1.1.56

Chromosomal Location of Human Ortholog: 18p11.21

Cellular Component: nucleoplasm; mRNA cap complex; nucleolus; nucleus; receptor complex

Molecular Function: protein binding; RNA binding; mRNA (guanine-N7-)-methyltransferase activity

Biological Process: transcription from RNA polymerase II promoter; mRNA capping; viral reproduction; gene expression

Research Articles on RNMT

Similar Products

Product Notes

The RNMT rnmt (Catalog #AAA3205272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNMT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's RNMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNMT rnmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETEDVPKDKS STGDGTQNKR KIALEDVPEK QKNLEEGHSS TVAAHYNELQ. It is sometimes possible for the material contained within the vial of "RNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.