Western Blot (WB)
(Western Blot analysis of C10orf59 expression in transfected 293T cell line by C10orf59 polyclonal antibody. Lane 1: C10orf59 transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human RNLS Polyclonal Antibody | anti-RNLS antibody
RNLS (Renalase, Monoamine Oxidase-C, MAO-C, C10orf59, FLJ11218) (FITC)
Gene Names
RNLS; C10orf59; RENALASE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RNLS; Polyclonal Antibody; RNLS (Renalase; Monoamine Oxidase-C; MAO-C; C10orf59; FLJ11218) (FITC); anti-RNLS antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C10orf59.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-RNLS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human C10orf59, aa1-342 (NP_001026879.1).
Immunogen Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of C10orf59 expression in transfected 293T cell line by C10orf59 polyclonal antibody. Lane 1: C10orf59 transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of C10orf59 expression in transfected 293T cell line by C10orf59 polyclonal antibody. Lane 1: C10orf59 transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RNLS antibody
Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis. It is unlikely that renalase has physiologically relevant catecholamine-oxidizing activity.
Product Categories/Family for anti-RNLS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,949 Da
NCBI Official Full Name
renalase isoform 1
NCBI Official Synonym Full Names
renalase, FAD-dependent amine oxidase
NCBI Official Symbol
RNLS
NCBI Official Synonym Symbols
C10orf59; RENALASE
NCBI Protein Information
renalase
NCBI Description
Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]
Research Articles on RNLS
Similar Products
Product Notes
The RNLS (Catalog #AAA6371555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNLS (Renalase, Monoamine Oxidase-C, MAO-C, C10orf59, FLJ11218) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNLS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNLS for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNLS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
