Western Blot (WB)
(Host: RabbitTarget Name: RNF5Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human RNF5 Polyclonal Antibody | anti-RNF5 antibody
RNF5 Antibody - C-terminal region
Gene Names
RNF5; RMA1; RING5
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RNF5; Polyclonal Antibody; RNF5 Antibody - C-terminal region; anti-RNF5 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPFGFFTTVFNAHEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLL
Sequence Length
180
Applicable Applications for anti-RNF5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RNF5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RNF5Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RNF5Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNF5 antibody
This is a rabbit polyclonal antibody against RNF5. It was validated on Western Blot
Target Description: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
Target Description: The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions.
Product Categories/Family for anti-RNF5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF5
NCBI Official Synonym Full Names
ring finger protein 5
NCBI Official Symbol
RNF5
NCBI Official Synonym Symbols
RMA1; RING5
NCBI Protein Information
E3 ubiquitin-protein ligase RNF5
UniProt Protein Name
E3 ubiquitin-protein ligase RNF5
Protein Family
UniProt Gene Name
RNF5
UniProt Synonym Gene Names
G16; NG2; RMA1; HsRma1
UniProt Entry Name
RNF5_HUMAN
NCBI Description
The protein encoded by this gene contains a RING finger, which is a motif known to be involved in protein-protein interactions. This protein is a membrane-bound ubiquitin ligase. It can regulate cell motility by targeting paxillin ubiquitination and altering the distribution and localization of paxillin in cytoplasm and cell focal adhesions. [provided by RefSeq, Jul 2008]
Research Articles on RNF5
Similar Products
Product Notes
The RNF5 rnf5 (Catalog #AAA3213780) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF5 rnf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPFGFFTTVF NAHEPFRRGT GVDLGQGHPA SSWQDSLFLF LAIFFFFWLL. It is sometimes possible for the material contained within the vial of "RNF5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
