Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using RNF17 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Human RNF17 Polyclonal Antibody | anti-RNF17 antibody
RNF17 Polyclonal Antibody
Gene Names
RNF17; TDRD4; Mmip-2; SPATA23
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RNF17; Polyclonal Antibody; RNF17 Polyclonal Antibody; Mmip-2; SPATA23; TDRD4; anti-RNF17 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
VSAKSLPNENFQSLYNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEPVKWENDMHCAVKIQDKNQWRRGQIIRMVTDTLVEVLLYDVGVELVVNVDCLRKLEENLKTMGRLSLECSLVDIRPAGGSDKWTATACDCLSLYLTGAVATIILQVDSEENNTTWPLPVKIFCRDEKGERVDVSKYLIKKGLALRERRINNLDNSHSLSEKSLEVPLEQEDSVVTNCIKTNFDPDKKTADIISEQ
Sequence Length
1623
Applicable Applications for anti-RNF17 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human RNF17
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus
Positive Samples
A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using RNF17 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using RNF17 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-RNF17 antibody
This gene is similar to a mouse gene that encodes a testis-specific protein containing a RING finger domain. Alternatively spliced transcript variants encoding different isoforms have been found.
Product Categories/Family for anti-RNF17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 50kDa; 73kDa; 179kDa; 183kDa; 184kDa
Observed: 200kDa
Observed: 200kDa
NCBI Official Full Name
RING finger protein 17 isoform 1
NCBI Official Synonym Full Names
ring finger protein 17
NCBI Official Symbol
RNF17
NCBI Official Synonym Symbols
TDRD4; Mmip-2; SPATA23
NCBI Protein Information
RING finger protein 17
UniProt Protein Name
RING finger protein 17
Protein Family
UniProt Gene Name
RNF17
UniProt Synonym Gene Names
TDRD4
NCBI Description
This gene is similar to a mouse gene that encodes a testis-specific protein containing a RING finger domain. Alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, May 2010]
Uniprot Description
Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis ().
Research Articles on RNF17
Similar Products
Product Notes
The RNF17 rnf17 (Catalog #AAA9133830) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF17 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RNF17 rnf17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSAKSLPNEN FQSLYNKELP VHICNVISPE KIYVQWLLTE NLLNSLEEKM IAAYENSKWE PVKWENDMHC AVKIQDKNQW RRGQIIRMVT DTLVEVLLYD VGVELVVNVD CLRKLEENLK TMGRLSLECS LVDIRPAGGS DKWTATACDC LSLYLTGAVA TIILQVDSEE NNTTWPLPVK IFCRDEKGER VDVSKYLIKK GLALRERRIN NLDNSHSLSE KSLEVPLEQE DSVVTNCIKT NFDPDKKTAD IISEQ. It is sometimes possible for the material contained within the vial of "RNF17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
