Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-RNF152 Polyclonal Antibody)

Rabbit anti-Human RNF152 Polyclonal Antibody | anti-RNF152 antibody

RNF152 Polyclonal Antibody

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RNF152; Polyclonal Antibody; RNF152 Polyclonal Antibody; ring finger protein 152; anti-RNF152 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.26 mg/ml (varies by lot)
Sequence Length
203
Applicable Applications for anti-RNF152 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RNF152 (NP_775828.1).
Immunogen Sequence
YMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVI
Positive Samples
U-251MG, 293T, LO2
Cellular Location
Lysosome Membrane, Single-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-RNF152 Polyclonal Antibody)

Western Blot (WB) (Western blot-RNF152 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 22kDa
Observed: 22kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF152
NCBI Official Synonym Full Names
ring finger protein 152
NCBI Official Symbol
RNF152
NCBI Protein Information
E3 ubiquitin-protein ligase RNF152
UniProt Protein Name
E3 ubiquitin-protein ligase RNF152
UniProt Gene Name
RNF152
UniProt Entry Name
RN152_HUMAN

Uniprot Description

RNF152: E3 ubiquitin-protein ligase mediating 'Lys-48'-linked polyubiquitination of target proteins and their subsequent targeting to the proteasome for degradation. Induces apoptosis when overexpressed. Belongs to the RNF152 family.

Protein type: EC 6.3.2.19; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system; Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q21.33

Cellular Component: lysosome; lysosomal membrane; integral to membrane

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: apoptosis

Research Articles on RNF152

Similar Products

Product Notes

The RNF152 rnf152 (Catalog #AAA9140945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF152 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF152 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the RNF152 rnf152 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF152, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.