Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RMI1 expression in transfected 293T cell line by RMI1 polyclonal antibody. Lane 1: C9orf76 transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RMI1 Polyclonal Antibody | anti-RMI1 antibody

RMI1 (RecQ-mediated Genome Instability Protein 1, BLM-associated Protein of 75 kDa, BLAP75, C9orf76, FAAP75, RP11-346I8.1)

Gene Names
RMI1; BLAP75; FAAP75; C9orf76; RP11-346I8.1
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RMI1; Polyclonal Antibody; RMI1 (RecQ-mediated Genome Instability Protein 1; BLM-associated Protein of 75 kDa; BLAP75; C9orf76; FAAP75; RP11-346I8.1); Anti -RMI1 (RecQ-mediated Genome Instability Protein 1; anti-RMI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RMI1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAHSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIERFSHNPNTTNNFSLTCKNGNNNWSEKNVSEQMTNEDKSFGCPSVRDQNRSIFSVHCNVPLAHDFTNKEKNLETDNKIKQTSSSDSHSLNNKILIERWSTMYRKGIHKFLMKMIVIYRVVL
Applicable Applications for anti-RMI1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human RMI1, aa1-470 (AAH64937.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RMI1 expression in transfected 293T cell line by RMI1 polyclonal antibody. Lane 1: C9orf76 transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RMI1 expression in transfected 293T cell line by RMI1 polyclonal antibody. Lane 1: C9orf76 transfected lysate (51.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to RMI1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to RMI1 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-RMI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,144 Da
NCBI Official Full Name
recQ-mediated genome instability protein 1
NCBI Official Synonym Full Names
RecQ mediated genome instability 1
NCBI Official Symbol
RMI1
NCBI Official Synonym Symbols
BLAP75; FAAP75; C9orf76; RP11-346I8.1
NCBI Protein Information
recQ-mediated genome instability protein 1; BLM-associated protein 75 kDa; BLM-associated polypeptide, 75 kDa; RMI1, RecQ mediated genome instability 1, homolog; homolog of yeast RecQ-mediated genome instability 1 (RMI1)
UniProt Protein Name
RecQ-mediated genome instability protein 1
UniProt Gene Name
RMI1
UniProt Synonym Gene Names
C9orf76; BLAP75
UniProt Entry Name
RMI1_HUMAN

NCBI Description

RMI1 is a component of protein complexes that limit DNA crossover formation via the dissolution of double Holliday junctions (Raynard et al., 2006 [PubMed 16595695]).[supplied by OMIM, Mar 2008]

Uniprot Description

RMI1: Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. Promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. Required for BLM phosphorylation during mitosis. Within the BLM complex, required for BLM and TOP3A stability. Belongs to the RMI1 family.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 9q21.32

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: multicellular organism growth; response to glucose stimulus; glucose homeostasis; DNA replication; reduction of food intake in response to dietary excess

Research Articles on RMI1

Similar Products

Product Notes

The RMI1 rmi1 (Catalog #AAA644630) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RMI1 (RecQ-mediated Genome Instability Protein 1, BLM-associated Protein of 75 kDa, BLAP75, C9orf76, FAAP75, RP11-346I8.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RMI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RMI1 rmi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNVTSIALRA ETWLLAAWHV KVPPMWLEAC INWIQEENNN VNLSQAQMNK QVFEQWLLTD LRDLEHPLLP DGILEIPKGE LNGFYALQIN SLVDVSQPAH SQIQKLRGKN TTNDLVTAEA QVTPKPWEAK PSRMLMLQLT DGIVQIQGME YQPIPILHSD LPPGTKILIY GNISFRLGVL LLKPENVKVL GGEVDALLEE YAQEKVLARL IGEPDLVVSV IPNNSNENIP RVTDVLDPAL GPSDEELLAS LDENDELTAN NDTSSERCFT TGSSSNTIPT RQSSFEPEFV ISPRPKEEPS NLSIHVMDGE LDDFSLEEAL LLEETVQKEQ METKELQPLT FNRNADRSIE RFSHNPNTTN NFSLTCKNGN NNWSEKNVSE QMTNEDKSFG CPSVRDQNRS IFSVHCNVPL AHDFTNKEKN LETDNKIKQT SSSDSHSLNN KILIERWSTM YRKGIHKFLM KMIVIYRVVL. It is sometimes possible for the material contained within the vial of "RMI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.