Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Heart)

Rabbit RIPK3 Polyclonal Antibody | anti-RIPK3 antibody

RIPK3 antibody - N-terminal region

Gene Names
RIPK3; RIP3
Reactivity
Tested Species Reactivty: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RIPK3; Polyclonal Antibody; RIPK3 antibody - N-terminal region; RIP3; RIP3 beta; RIP3 gamma; anti-RIPK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivty: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
Sequence Length
518
Applicable Applications for anti-RIPK3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3
Conjugation
Unconjugated
Protein Size (#AA)
518 amino acids
Protein Interactions
BMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Heart)

Immunohistochemistry (IHC) (Human Heart)

Immunohistochemistry (IHC)

(Human Liver)

Immunohistochemistry (IHC) (Human Liver)

Immunohistochemistry (IHC)

(RIPK3 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pancreas TissueObserved Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cellsPrimary Antibody Concentration: 3 -12 ug/mlSecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure: 0.2 seconds)

Immunohistochemistry (IHC) (RIPK3 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pancreas TissueObserved Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cellsPrimary Antibody Concentration: 3 -12 ug/mlSecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure: 0.2 seconds)

Western Blot (WB)

(Host: RabbitTarget Name: RIPK3Sample Type: Lane 1: Transient overexpression lysate of RIPK3Lane 2: Non-overexpressed vector control lysateAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIPK3Sample Type: Lane 1: Transient overexpression lysate of RIPK3Lane 2: Non-overexpressed vector control lysateAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human HepG2)

Western Blot (WB) (WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human HepG2)

Western Blot (WB)

(WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human Jurkat)

Western Blot (WB) (WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human Jurkat)

Western Blot (WB)

(WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB)

(Host: RabbitTarget: RIPK3Positive control (+): THP-1 (N30)Negative control (-): A549 (N03)Antibody concentration: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget: RIPK3Positive control (+): THP-1 (N30)Negative control (-): A549 (N03)Antibody concentration: 1ug/ml)

Western Blot (WB)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Western Blot (WB) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
Related Product Information for anti-RIPK3 antibody
This is a rabbit polyclonal antibody against RIPK3. It was validated on Western Blot and immunohistochemistry

Target Description: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 3
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 3
NCBI Official Symbol
RIPK3
NCBI Official Synonym Symbols
RIP3
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 3
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 3
UniProt Gene Name
RIPK3
UniProt Synonym Gene Names
RIP3; RIP-3
UniProt Entry Name
RIPK3_HUMAN

NCBI Description

The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. [provided by RefSeq, Jul 2008]

Uniprot Description

RIPK3: Promotes apoptosis. Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Binds TRAF2 and RIPK1 and is recruited to the TNFR-1 signaling complex. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; Kinase, protein; TKL group; RIPK family

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: mitochondrion; plasma membrane; cytosol

Molecular Function: NF-kappaB-inducing kinase activity; protein serine/threonine kinase activity; identical protein binding; protein binding; transcription coactivator activity; protein complex binding; ATP binding; protein kinase activity

Biological Process: spleen development; I-kappaB kinase/NF-kappaB cascade; regulation of activated T cell proliferation; thymus development; protein heterooligomerization; protein amino acid autophosphorylation; MyD88-independent toll-like receptor signaling pathway; T cell differentiation in the thymus; protein modification process; toll-like receptor 3 signaling pathway; signal transduction; lymph node development; activation of NF-kappaB transcription factor; regulation of T cell mediated cytotoxicity; regulation of adaptive immune response; regulation of interferon-gamma production; toll-like receptor signaling pathway; positive regulation of interferon type I production; activation of protein kinase activity; innate immune response; T cell homeostasis; positive regulation of ligase activity; toll-like receptor 4 signaling pathway; protein homooligomerization; positive regulation of oxidoreductase activity

Research Articles on RIPK3

Similar Products

Product Notes

The RIPK3 ripk3 (Catalog #AAA3200470) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK3 antibody - N-terminal region reacts with Tested Species Reactivty: Human Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the RIPK3 ripk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGSQSGTGSG EPGGTLGYLA PELFVNVNRK ASTASDVYSF GILMWAVLAG. It is sometimes possible for the material contained within the vial of "RIPK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.