Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RIPK2Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RIPK2 Polyclonal Antibody | anti-RIPK2 antibody

RIPK2 Antibody - middle region

Gene Names
RIPK2; CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RIPK2; Polyclonal Antibody; RIPK2 Antibody - middle region; anti-RIPK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCY
Sequence Length
540
Applicable Applications for anti-RIPK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIPK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RIPK2Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RIPK2Sample Tissue: Human Nerve Fiber Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RIPK2 antibody
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Product Categories/Family for anti-RIPK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 2
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 2
NCBI Official Symbol
RIPK2
NCBI Official Synonym Symbols
CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 2
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 2
UniProt Gene Name
RIPK2
UniProt Synonym Gene Names
CARDIAK; RICK; RIP2; CARD-containing IL-1 beta ICE-kinase; RIP-2
UniProt Entry Name
RIPK2_HUMAN

NCBI Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq, Jul 2008]

Uniprot Description

RIPK2: a tyrosine kinase-like kinase of the RIPK family. Activates pro-caspase-1 and pro-caspase-8. Potentiates casp-8-mediated apoptosis. May activate NF-kappaB.

Protein type: EC 2.7.10.2; Kinase, protein; Protein kinase, TKL; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); TKL group; RIPK family

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: cytoskeleton; protein complex; cytoplasm; cytosol; vesicle

Molecular Function: protein serine/threonine kinase activity; signal transducer activity; LIM domain binding; protein binding; protein homodimerization activity; non-membrane spanning protein tyrosine kinase activity; CARD domain binding; ATP binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; peptidyl-tyrosine phosphorylation; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; activation of MAPK activity; apoptosis; positive regulation of interleukin-12 production; stress-activated MAPK cascade; positive regulation of JNK cascade; toll-like receptor 3 signaling pathway; signal transduction; T cell receptor signaling pathway; toll-like receptor 10 signaling pathway; activation of NF-kappaB transcription factor; T cell proliferation; toll-like receptor 5 signaling pathway; response to exogenous dsRNA; positive regulation of immature T cell proliferation; lipopolysaccharide-mediated signaling pathway; positive regulation of interferon-beta production; JNK cascade; inflammatory response; toll-like receptor 4 signaling pathway; positive regulation of interferon-alpha production; adaptive immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; MyD88-independent toll-like receptor signaling pathway; positive regulation of interleukin-6 production; positive regulation of tumor necrosis factor production; positive regulation of peptidyl-serine phosphorylation; positive regulation of chemokine production; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; positive regulation of interferon-gamma production; positive regulation of peptidyl-tyrosine phosphorylation; defense response to Gram-positive bacterium; positive regulation of protein ubiquitination; positive regulation of interleukin-2 production; toll-like receptor signaling pathway; innate immune response; positive regulation of alpha-beta T cell proliferation; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; positive regulation of cytokine and chemokine mediated signaling pathway; positive regulation of T-helper 1 cell differentiation; negative regulation of apoptosis

Research Articles on RIPK2

Similar Products

Product Notes

The RIPK2 ripk2 (Catalog #AAA3221561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIPK2 ripk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLNIPVNHGP QEESCGSSQL HENSGSPETS RSLPAPQDND FLSRKAQDCY. It is sometimes possible for the material contained within the vial of "RIPK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.