Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RIC8B antibody (MBS5301124) used at 1 ug/ml to detect target protein.)

Rabbit RIC8B Polyclonal Antibody | anti-RIC8B antibody

RIC8B antibody

Gene Names
RIC8B; RIC8; hSyn
Applications
Western Blot
Purity
Affinity purified
Synonyms
RIC8B; Polyclonal Antibody; RIC8B antibody; Polyclonal RIC8B; Anti-RIC8B; hSyn; MGC39476; RICB-8; RICB 8; Resistance To Inhibitors Of Cholinesterase 8 Homolog B; FLJ10620; RIC8; anti-RIC8B antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIC8B antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
496
Applicable Applications for anti-RIC8B antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(RIC8B antibody (MBS5301124) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (RIC8B antibody (MBS5301124) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-RIC8B antibody
Rabbit polyclonal RIC8B antibody
Product Categories/Family for anti-RIC8B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
59 kDa (MW of target protein)
NCBI Official Full Name
RIC8B protein
NCBI Official Synonym Full Names
RIC8 guanine nucleotide exchange factor B
NCBI Official Symbol
RIC8B
NCBI Official Synonym Symbols
RIC8; hSyn
NCBI Protein Information
synembryn-B
UniProt Protein Name
Synembryn-B
Protein Family
UniProt Gene Name
RIC8B
UniProt Synonym Gene Names
hSyn
UniProt Entry Name
RIC8B_HUMAN

Uniprot Description

RIC8B: a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction. Interacts with GDP-bound G alpha proteins GNAI1, GNAL, GNAS and GNAQ. Does not interact with G-alpha proteins when they are in complex with subunits beta and gamma. Belongs to the synembryn family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, misc.

Chromosomal Location of Human Ortholog: 12q23.3

Cellular Component: centrosome; cytoplasm; plasma membrane; cell cortex; cytosol

Molecular Function: guanyl-nucleotide exchange factor activity; G-protein alpha-subunit binding; GTPase activator activity

Biological Process: regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Research Articles on RIC8B

Similar Products

Product Notes

The RIC8B ric8b (Catalog #AAA5301124) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RIC8B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RIC8B ric8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIC8B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.