Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Ribophorin II antibody (MBS5303216) used at 1 ug/ml to detect target protein.)

Rabbit Ribophorin II Polyclonal Antibody | anti-RPN2 antibody

Ribophorin II antibody

Gene Names
RPN2; SWP1; RPNII; RIBIIR; RPN-II
Applications
Western Blot
Purity
Affinity purified
Synonyms
Ribophorin II; Polyclonal Antibody; Ribophorin II antibody; Polyclonal Ribophorin II; Anti-Ribophorin II; RPNII; SWP1; RIBIIR; RPN-II; RPN2; anti-RPN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Ribophorin II antibody was raised against the middle region of RPN2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPN2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
631
Applicable Applications for anti-RPN2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.
Cross-Reactivity
Human
Immunogen
Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Ribophorin II antibody (MBS5303216) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Ribophorin II antibody (MBS5303216) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-RPN2 antibody
Rabbit polyclonal Ribophorin II antibody raised against the middle region of RPN2
Product Categories/Family for anti-RPN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
67 kDa (MW of target protein)
NCBI Official Full Name
ribophorin II
NCBI Official Synonym Full Names
ribophorin II
NCBI Official Symbol
RPN2
NCBI Official Synonym Symbols
SWP1; RPNII; RIBIIR; RPN-II
NCBI Protein Information
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
UniProt Protein Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
Protein Family
UniProt Gene Name
RPN2
UniProt Synonym Gene Names
RPN-II
UniProt Entry Name
RPN2_HUMAN

NCBI Description

This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

RPN2: Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Belongs to the SWP1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.4.99.18; Membrane protein, integral; Glycan Metabolism - N-glycan biosynthesis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 20q12-q13.1

Cellular Component: endoplasmic reticulum membrane; rough endoplasmic reticulum; membrane; endoplasmic reticulum; oligosaccharyl transferase complex; integral to membrane; nucleus

Molecular Function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity; ribosome binding

Biological Process: response to drug; SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; protein modification process; gene expression; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification; aging

Research Articles on RPN2

Similar Products

Product Notes

The RPN2 rpn2 (Catalog #AAA5303216) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ribophorin II can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the RPN2 rpn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ribophorin II, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.