Western Blot (WB)
(Host: RabbitTarget Name: RHOFSample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit RHOF Polyclonal Antibody | anti-RHOF antibody
RHOF Antibody - N-terminal region
Gene Names
RHOF; RIF; ARHF
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHOF; Polyclonal Antibody; RHOF Antibody - N-terminal region; anti-RHOF antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAG
Sequence Length
211
Applicable Applications for anti-RHOF antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RHOFSample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RHOFSample Type: Lymph Node Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RHOF antibody
This is a rabbit polyclonal antibody against RHOF. It was validated on Western Blot
Target Description: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state.It causes the formation of thin, actin-rich surface projections called filopodia. And it functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin- based morphology.
Target Description: RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state.It causes the formation of thin, actin-rich surface projections called filopodia. And it functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin- based morphology.
Product Categories/Family for anti-RHOF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoF
NCBI Official Synonym Full Names
ras homolog family member F, filopodia associated
NCBI Official Symbol
RHOF
NCBI Official Synonym Symbols
RIF; ARHF
NCBI Protein Information
rho-related GTP-binding protein RhoF
UniProt Protein Name
Rho-related GTP-binding protein RhoF
Protein Family
UniProt Gene Name
RHOF
UniProt Synonym Gene Names
ARHF; RIF
UniProt Entry Name
RHOF_HUMAN
Research Articles on RHOF
Similar Products
Product Notes
The RHOF rhof (Catalog #AAA3213291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOF Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RHOF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOF rhof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGGCGKTSLL MVYSQGSFPE HYAPSVFEKY TASVTVGSKE VTLNLYDTAG. It is sometimes possible for the material contained within the vial of "RHOF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
