Rabbit RHOB Polyclonal Antibody | anti-RHOB antibody
Anti-RHOB Antibody
Gene Names
RHOB; ARH6; ARHB; RHOH6; MST081; MSTP081
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
RHOB; Polyclonal Antibody; Anti-RHOB Antibody; Rho-related GTP-binding protein RhoB; Rho cDNA clone 6; h6; ARH6; ARHB; Ras homolog family member B; anti-RHOB antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
196
Applicable Applications for anti-RHOB antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Immunogen
A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for anti-RHOB antibody
Description: Rabbit IgG polyclonal antibody for RHOB detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Background: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
Background: Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
References
1. Cannizzaro, L. A., Madaule, P., Hecht, F., Axel, R., Croce, C. M., Huebner, K. Chromosome localization of human ARH genes, a ras-related gene family. Genomics 6: 197-203, 1990. 2. Chardin, P., Madaule, P., Tavitian, A. Coding sequence of human rho cDNAs clone 6 and clone 9. Nucleic Acid Res. 16: 2717 only, 1988. 3. Madaule, P., Axel, R. A novel ras-related gene family. Cell 41: 31-40, 1985.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22,123 Da
NCBI Official Full Name
rho-related GTP-binding protein RhoB
NCBI Official Synonym Full Names
ras homolog family member B
NCBI Official Symbol
RHOB
NCBI Official Synonym Symbols
ARH6; ARHB; RHOH6; MST081; MSTP081
NCBI Protein Information
rho-related GTP-binding protein RhoB
UniProt Protein Name
Rho-related GTP-binding protein RhoB
Protein Family
UniProt Gene Name
RHOB
UniProt Synonym Gene Names
ARH6; ARHB; h6
Uniprot Description
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Research Articles on RHOB
Similar Products
Product Notes
The RHOB rhob (Catalog #AAA1751356) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-RHOB Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHOB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. WB: 0.1-0.5 mug/ml IHC-P: 0.5-1 mug/ml Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Researchers should empirically determine the suitability of the RHOB rhob for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
