Western Blot (WB)
(WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Rabbit RHBG Polyclonal Antibody | anti-RHBG antibody
RHBG antibody - N-terminal region
Gene Names
RHBG; SLC42A2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHBG; Polyclonal Antibody; RHBG antibody - N-terminal region; anti-RHBG antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RYNHKTDAALWHRSNHSNADNEFYFRYPSFQDVHAMVFVGFGFLMVFLQR
Sequence Length
441
Applicable Applications for anti-RHBG antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Sheep: 80%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RHBG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-RHBG antibody
This is a rabbit polyclonal antibody against RHBG. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.
Target Description: RHBG and RHCG are non-erythroid members of the Rhesus (Rh) protein family that are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. Rh family proteins are all predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini.
Product Categories/Family for anti-RHBG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
ammonium transporter Rh type B isoform a
NCBI Official Synonym Full Names
Rh family B glycoprotein (gene/pseudogene)
NCBI Official Symbol
RHBG
NCBI Official Synonym Symbols
SLC42A2
NCBI Protein Information
ammonium transporter Rh type B
UniProt Protein Name
Ammonium transporter Rh type B
Protein Family
UniProt Gene Name
RHBG
UniProt Synonym Gene Names
Rh family type B glycoprotein; Rh type B glycoprotein
UniProt Entry Name
RHBG_HUMAN
NCBI Description
This gene encodes one of two non-erythroid members of the Rhesus (Rh) protein family. Non-erythroid Rh protein family members are mainly expressed in the kidney and belong to the methylammonium-ammonium permease/ammonia transporters superfamily. All Rh family proteins are predicted to be transmembrane proteins with 12 membrane spanning domains and intracytoplasmic N- and C-termini. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Uniprot Description
Functions as a specific ammonium transporter.
Research Articles on RHBG
Similar Products
Product Notes
The RHBG rhbg (Catalog #AAA3209488) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHBG antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RHBG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHBG rhbg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RYNHKTDAAL WHRSNHSNAD NEFYFRYPSF QDVHAMVFVG FGFLMVFLQR. It is sometimes possible for the material contained within the vial of "RHBG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
