Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver.)

Rabbit anti-Human RGS5 Polyclonal Antibody | anti-RGS5 antibody

RGS5 (Regulator of G-Protein Signaling 5, Regulator of G-Protein Signaling 5, RGS-5, MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129) (PE)

Gene Names
RGS5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RGS5; Polyclonal Antibody; RGS5 (Regulator of G-Protein Signaling 5; Regulator of G-Protein Signaling 5; RGS-5; MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129) (PE); anti-RGS5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RGS5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RGS5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RGS5, aa1-181 (NP_003608.1).
Immunogen Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver.)

Western Blot (WB) (RGS5 rabbit polyclonal antibody. Western Blot analysis of RGS5 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of RGS5 expression in transfected 293T cell line by RGS5 polyclonal antibody. Lane 1: RGS5 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RGS5 expression in transfected 293T cell line by RGS5 polyclonal antibody. Lane 1: RGS5 transfected lysate (20.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RGS5 antibody
The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. The mRNA of the human gene is abundantly expressed in heart, lung, skeletal muscle, and small intestine, and at low levels in brain, placenta, liver, colon, and leukocytes.
Product Categories/Family for anti-RGS5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,946 Da
NCBI Official Full Name
regulator of G-protein signaling 5 isoform 1
NCBI Official Synonym Full Names
regulator of G-protein signaling 5
NCBI Official Symbol
RGS5
NCBI Official Synonym Symbols
MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129
NCBI Protein Information
regulator of G-protein signaling 5; OTTHUMP00000032361; OTTHUMP00000232302
UniProt Protein Name
Regulator of G-protein signaling 5
UniProt Gene Name
RGS5
UniProt Synonym Gene Names
RGS5
UniProt Entry Name
RGS5_HUMAN

Uniprot Description

RGS5: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, RGS

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: cytoplasm; plasma membrane

Molecular Function: GTPase activator activity

Biological Process: signal transduction; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of GTPase activity

Disease: Hypertension, Essential

Similar Products

Product Notes

The RGS5 rgs5 (Catalog #AAA6392484) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS5 (Regulator of G-Protein Signaling 5, Regulator of G-Protein Signaling 5, RGS-5, MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RGS5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RGS5 rgs5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RGS5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.